SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015403 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015403
Domain Number 1 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-27
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.06e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 148-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.53e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.81e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 63-120
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.23e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 9-64
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 473-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 9 Region: 110-142
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000086
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 10 Region: 278-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000258
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 11 Region: 194-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000019
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015403   Gene: ENSMODG00000012298   Transcript: ENSMODT00000015689
Sequence length 531
Comment pep:novel chromosome:BROADO5:Un:37591317:37593039:1 gene:ENSMODG00000012298 transcript:ENSMODT00000015689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYMCRGDYGYIENLDVHQKIDTGGKPYECNQCGKTFACKSHLIAHQRIHTGQKPFDCSQC
GKAFSQKSTLTVHQRIHTGETPYICNQCGKAFRSRNSLVTHQRICNGEKPFKCNQCGKTF
IRRTKLTVHQRIHTGEKPFECNQCGKAFRGRDVLILHQRIHTGQKPFDCNQCGKAFSQKS
GLTEHQRIHTGEKPYECNQCGKAFRYRNNLVTHQRLCNGEKPFKCNQCGKAFRSRNSMVK
HQRIHTGQKPFKCNQCGKAFIHKSTLTVHQRIHTGEKPFECNQCGKAFRGRDVLILHQRI
HTGQKPFDCNQCGKAFSQKSGLTEHQRIHTGEKPYECNQCGKAFIQRNRLIVHQRMHTGE
KPFECSLCGKAFTEKSGLTAHQRIHTGEKPYECNQCGKAFIWRNKLTIHQRIHTGEKPFE
CNQCGKAFIQKTKLTVHQRIHTGEKPFECNQCGKAFSQKSGLTVHQRIHTGEKPYECNQC
GKAFIWRNKLTIHQRIHTGEKPFECNQCGKAFTQKARLTVHQKIHTREKSY
Download sequence
Identical sequences H9H6J9
ENSMODP00000015403 13616.ENSMODP00000015403 ENSMODP00000015403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]