SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015405 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015405
Domain Number 1 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-27
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-26
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 115-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 59-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.12e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 6 Region: 6-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 357-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 162-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000675
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015405   Gene: ENSMODG00000012298   Transcript: ENSMODT00000015691
Sequence length 411
Comment pep:novel chromosome:BROADO5:Un:37591459:37593027:1 gene:ENSMODG00000012298 transcript:ENSMODT00000015691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACDSTWRENLDVHQKIDTGGKPYECNQCGKTFACKSHLIAHQRIHTGQKPFDCSQCGKAF
SQKSTLTVHQRIHTGETPYICNQCGKAFRSRNSLVTHQRICNGEKPFKCNQCGKTFIRRT
KLTVHQRIHTGEKPFECNQCGKAFRGRDVLILHQRIHTGQKPFDCNQCGKAFSQKDVLIL
HQRIHTGQKPFDCNQCGKAFSQKSGLTEHQRIHTGEKPYECNQCGKAFIQRNRLIVHQRM
HTGEKPFECSLCGKAFTEKSGLTAHQRIHTGEKPYECNQCGKAFIWRNKLTIHQRIHTGE
KPFECNQCGKAFIQKTKLTVHQRIHTGEKPFECNQCGKAFSQKSGLTVHQRIHTGEKPYE
CNQCGKAFIWRNKLTIHQRIHTGEKPFECNQCGKAFTQKARLTVHQKIHTR
Download sequence
Identical sequences H9H6K0
ENSMODP00000015405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]