SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015411 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015411
Domain Number 1 Region: 1201-1258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 1002-1058
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-18
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 1823-1875
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 694-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.76e-17
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 507-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000283
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 8 Region: 1243-1295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000315
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 9 Region: 1773-1838
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000169
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 10 Region: 739-791
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000919
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 1043-1095
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000021
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 96-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000121
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 13 Region: 198-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000162
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 14 Region: 1734-1787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000625
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 15 Region: 38-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000591
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 16 Region: 132-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000404
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015411
Domain Number - Region: 283-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00178
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015411   Gene: ENSMODG00000012304   Transcript: ENSMODT00000015697
Sequence length 1925
Comment pep:known_by_projection chromosome:BROADO5:3:305966366:306210234:1 gene:ENSMODG00000012304 transcript:ENSMODT00000015697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGRPPKPKETKTSGETDGVLTLNAENTNYAYQVPNFHKCDICLLSFPKETQFQRHMRD
HEQNDKPHRCDQCPLSFNVEFNLTLHKCTHNGEDPTCPVCNKKFSRVASLKAHIMLHEKE
ENLICSECGDEFTLQSQLSIHMEEHRQELVGNRIYACKSCKKEFETSSQLKEHMKTHYKI
RVSNTRSYNRNIDRSGFTYSCPHCGKTFQKPSQLTRHIRIHTGERPFKCSECGKAFNQKG
ALQTHMIKHTGEKPHACAFCPAAFSQKGNLQSHIQRVHSEVKNGPTYNCTECSCIFKSLG
SLNTHISKMHMGGPQNSASSTTETTHITTDSISPSQNTTSTTLLQPVDNKWKNATLFQPS
PLQQTETSATSSASQQGPQAVTDVIQQLLELSEPGQVETNSSPQPGQQLNIAVGINQDIL
QQALENSGLSSIPVAAHPNDSNQTKTSASQIQNSDIHSVSNEPPDPTEAEQDKEQDTSDK
LDKKEKKVIKKKSPFLPGSIREENGIRWHVCPYCTKEFKKPSDLVRHIRIHTHEKPFKCP
QCFRAFAVKSTLTAHIKTHTGIKAFKCQYCMKCFSTSGSLKVHIRLHTGVRPFACPHCDK
KFRTSGHRKTHIASHFKHTELRKLRHQRKPAKVRVGKSNVPVPDIPLQEPILITDLGLIQ
PIPRNSQFFQSYFNNNFVNEADRPYKCFYCHRAYKKSCHLKQHIRSHTGEKPFKCSQCGR
GFVSAGVLKAHIRTHTGLKAFKCLICNGAFTTGGSLRRHMGIHNDLRPYMCPYCQKTFKT
SLNCKKHMKTHRYELAQQLQQHQQAASIDDTTVDQQTIHVSTQMQVEVESDELRQSEAVT
ADHEAILELDQQHVVGPEETDLGQQLTDQPLEPDEDRFVTSEHTLQDNINQFEQQTIPQQ
SYEPTGLPQGFAVTDTFNQNQFPPVQQLQDSSTLESQALSTSFHQQNLLQVPNTDTINVT
TRLIQEHSQEEMELQTQRPQFLEDNEDQSRRAYRCEYCNKGFKKSSHLKQHVRSHTGEKP
YKCKLCGRGFVSSGVLKSHEKTHTGVKAFSCNICNASFTTNGSLTRHMATHMSMKPYKCP
FCEESFRTTVHCKKHMKKHQTVSSPVVTAGEGGGGVACMEEEDENSERTAPRKSRPGVIT
FTEEETAELAKIRPRESATVSEKVLVQSAAEKDRISEIKDKQAELEAEPKYANCCTYCPK
SFKKPSDLVRHVRIHTGEKPYKCDECGKSFTVKSTLDCHVKTHTGQKLFSCHVCSNSFST
KGSLKVHMRLHTGAKPFKCPHCDLRFRTSGRRKTHIQCHYKPENKKIRKPMSRSPNESLQ
PVGLLNSSSADPNVFIMNNSVLTGQFDQNLLQQGLVSQAILPASMSAGGDLTVSLTDGSL
ATLEGIQLQLAGNLVGPNVQISGIDASSINNITLQIDPSILQQTLQQSNILAQQLTGEPN
LSTQNNSLQTPDSTVPANVVIQPISSLSLQPTVTSSANMTIGPLSEQDSMLTSSNNGTQD
LSQVMTSQGLVSTSNGQHEITLTINNSSLSQVLAHAAGSTAPTSSGSSQEITLTISGQDL
IQHNTNGNSELNGSIRLSAPAVSNQPPGATLTISNDQLLSQSTTLNSSDLNTAAGNLPSA
TSMSPSTIATQNLVMSSSGVGGDASVTLTLADTQGMLSGGLDAVTLNITSQAQQFPALLT
DSSLSGQSGTGSQQVILVSHTPHSTSGNSDELTYQVTDVSPNLNKSSQSEKEGRVHQCFE
CNRTFSSATMLMHHSKEVHGKERIHVCPICSKAFKRATHLKEHMQTHQAGPSLSSQKPRV
FKCDTCEKAFAKPSQLERHSRIHTGERPFHCTLCEKAFNQKSALQVHMKKHTGERPYKCD
YCAMGFTQKSNMKLHMKRAHSYTGTLQESASHQEQEGEDLHRALHLEEVGQETSNEWQSL
TNVFR
Download sequence
Identical sequences F7EJ15
ENSMODP00000015411 ENSMODP00000015411 XP_007487861.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]