SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015420 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015420
Domain Number 1 Region: 194-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-27
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-26
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 502-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.32e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 557-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 669-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 137-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 725-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 613-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 334-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 11 Region: 446-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 12 Region: 781-832
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 13 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-16
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 14 Region: 240-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000966
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 15 Region: 84-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000878
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015420   Gene: ENSMODG00000022793   Transcript: ENSMODT00000015706
Sequence length 832
Comment pep:novel chromosome:BROADO5:Un:24979210:24986437:-1 gene:ENSMODG00000022793 transcript:ENSMODT00000015706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQDVAVDFTREEWCLLSPPQKELYREVMLENVRNLLSVEREIRPEKKLTATEVSLSVEE
MNLQRFMIDCPDNFAFREFCVAPQNSSHFEHQGIHPGGKSSEGNQCRKTFMHRAIHVGHQ
RRQSLKKPYECKQCGKTFSQSSHLAVHQRIHSGEKPYECKECGKTFNQNYHLAIHQRIHT
GEKPFECKQCGKRFSENSSLAVHQRIHTGEKPYECNQCGKTFSQRSNLAVHQRIHTGEKP
YECNQCGKTFNQSYHLAIHQRIHTGEKPFECKQCGKSFTMKSSLAVHQRIHTGEKPFECN
QCGKRFTMKSSLAVHQKIHTGEKPFECNQCGKRFIMKSSLTVHQRMHTGEKPYECKQCGK
RFSENSSLVVHQMIHTGEKPYECNQCGKTFSRSSRLAVHQRIHTGEKPYECTQCGKTFSQ
RSILTVHQRIHSGEKPYECNQCGKRFIMKSSLAVHQRMHTGEKPFECKQCGKSFTMKSSL
AVHQRIHTGEKPFECKQCGKRFSENSSLVVHQIIHTGEKPYECNQCGKTFSLRSHLARHQ
RIHTGEKPYECNQCGKTFSQRSNLAVHQRIHSGEKPYECNQCGKAFSQKSSLAVHQRIHS
SEKPYDCKECGKTFSMSSHLAVHQRIHSGEKPYECNQCGKTFSMSSSLAVHQRIHSGEKP
YECNQCRKTFCRSSSLAEHQRIHTGEKPYECIQCGKAFSQSSSLAVHQRIHSGEKPYECN
QCGKTFSTSSHLAVHQRIHSGEKPYECNQCGNTFNMSSHLAVHQRIHSGEKPYECNQCGK
TFSQRSNLSVHQRIHTGEKPYECIQCGKAFSRSSSLAVHERIHTGEKPYECK
Download sequence
Identical sequences H9H6K1
ENSMODP00000015420 ENSMODP00000015420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]