SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015449 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015449
Domain Number 1 Region: 1658-1714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-17
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 2 Region: 1720-1770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-17
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 1583-1635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000777
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 1436-1486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000262
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number 5 Region: 239-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000324
Family HkH motif-containing C2H2 finger 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015449
Domain Number - Region: 864-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00013
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number - Region: 1759-1801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000588
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 1560-1592
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000744
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 624-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000749
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 189-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00116
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 741-780
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00499
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 1032-1079
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0109
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 1503-1533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0125
Family Classic zinc finger, C2H2 0.075
Further Details:      
 
Domain Number - Region: 715-754
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0358
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 538-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0559
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015449   Gene: ENSMODG00000012332   Transcript: ENSMODT00000015735
Sequence length 2284
Comment pep:known_by_projection chromosome:BROADO5:3:302673820:303305510:1 gene:ENSMODG00000012332 transcript:ENSMODT00000015735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRDKNPENDEDESTETKRTRNFRNSNQNAECEALPVLKSDLSSDEVHIDPEKTEENGIN
KRGFSESSNPLNTDVDKNRNVHFPKRIKLDVSEYFKAEENDLQSSATAVGITVDGIQKPL
LNEFPDDDTCLPNLLSPNCDLSVADEAAPKKHAEKKYMENVVSLGSENVTSLHLEEISVS
CTVGDVDTVFKCKVCDQLFSSCSELEKHSETHIKQSQELICHQCSHKAENTSSLHAHIKQ
THGQQNIFCCDLCGFQCVEESLLDAHYLGKTHLRRQNLAARGGFVQILTKKSFCRKQYTA
DTEKIVRTKPRTRKSRSKNADSRELRNTQNKLQLLKESFSKPSGDNELFVEMVPSKNISS
ENLKSFEEDKAISLEVETNIKGQEKNLGPLGTSEDLLNKSEPTKNDPRTFHSINTGRRLD
RKRSERSVLMLNSGFRRRSGSFNLKSQAKKRLSLLGISKKGKNEAHSMYMKHLRTQMKPN
DAKSTAKQFETNNDVDSLCVITSATHEFMQIKTKSHHPSSTQFDSLIMKPLSSHQMLCTC
TYCGHVSENRNNLELHMKRCHGREVKFHCQTCDYSSFSLGDLDKHLKSNQHPEAGYIFSC
QCCSFISVNEVNLRDHMKEEHNLIFSCSHCNLFFLSSKDLAEHETTEQHINLSVQSKSSQ
SVSNALSLQAKTLNTSESSDNTKASSNKTEKAFQDDVHKLSKLNFGSEIKHSTLNKPQFQ
CKKCFYKTRSSTVLTRHIKLRHAQDYHFLCKACNLYSLSKEGMEKHIKRSKHLENARKNN
IGLRFEECIEKVCIGASDKKDESYISGNGTVEGNVESMQLQASSCFETKMPTNKEQASQI
TKDGELAFANTPKRGRPKGNISRTCSHCGLLASSITNLTVHIRRKHSHQYSYLCKVCNYY
TVTKGDMERHCATKKHKGRVGIETNGKQGADIIVCPEESNLESSRKITSSPVGPLEGSVN
NANEPVELGNTVFEKLSVEHGKRVEVEVENILHSLGQQGSGYFPDKKESLPPKSEELIQD
VEKSATVTNDNKCVHCEFVAHSSASLELHVKRKHTKEFEYYCMACDYYAVTRREMTRHAA
TEKHKIKRQSYVSCSSGDEGNVTDSSKKIIALHEEEEHEQDSKELQVNSDQTGYTLDISV
SDMAKSRRTEDCPLLDENTNVDISNVICTPDSVEVETREEYDLKEDHSVVETFHQPLAKD
KVVKSVERIPSKETSANDSPKMCQNPNQGSLDFNCEIIKENQHALNDVNGSDIHCQKNEE
ILGENGGKINNQQASTELQDEGHHTESNPSIVLRAAIEQSNLDENNINKVETMHSFEDGK
DLQDNESVVVKETLMDSQYENEIILEGDGPQPNTQECEAFETVDIDDKGRSMYNFDQFDS
SIVRIKNHQDDDSTEQSEESLITTGVKINELPFKDSIQGIKKKKTEGNSLIESTRIRCDD
CGFLADGLSGLNVHIAMKHPSKEKHFHCLLCGKSFYTESNLHQHLASAGHMRNEQASVEE
LPEGGATFKCVKCTEPFDSEQNLFLHIKGQHEELLREVNKYIVEDTEQINREREENQGNV
CKYCGKMCRSSNSMAFLAHIRTHTGSKPFKCKICHFATAQLGDARNHVKRHLGMREYKCH
VCGVAFVMKKHLNTHLLGKHGVGTPKERKFTCHLCDRSFTEKWALNNHMKLHTGEKPFKC
TWPTCHYSFLTASAMKDHYRTHTGEKSFLCDLCGFAGGTRHALTKHRRQHTGEKPFKCDE
CNFASTTQSHLTRHKRVHTGEKPYRCPWCDYRSNCAENIRKHILHTGKHEGVKMYNCPKC
DYGTNIPVEFRNHLKEQHPDIENPDLAYLHAGIVSKSYECRLKGQGATFVETDSPFTAAA
LAEGSPVKEKALRSSRRQAQSAEQVQQVIIIQGYNGDFAIDSSVEETAAATLQTLAMAGQ
VARVVHITEDGQVIATSQNGSHVGSMVPGQILTEQLADGATQVVVVEGSVGNTEVGESVD
SDGAVMQQVMKQEILDIAESGAPASDSSSALDALLCAVTELGEAENRTGPQERTRAGHKD
LLIQMPSHEASSVPAEPETQEIQMFQEIQESPSDVEPMEVVTQVMRPSTIITSQERAQVA
FKKMVQGVLQFAVCDTAAADQLMKEGVTQVIVNQEGTVHMVAREGSQIIMQEAGSHALNM
QGERVDLVESEGEISEIIVTEELAQAMAQDSSGNFTEGTTHYIVTELPQGVQDEPGMYSH
TVIETADSQELLQAGTALNAEAVAPDGAGEQLTSMVIYTQGGSPTAAFIQSQRESNELQE
LQEA
Download sequence
Identical sequences F7E2N5
ENSMODP00000015449 XP_001373864.2.35504 XP_007487858.1.35504 XP_016287210.1.35504 XP_016287211.1.35504 ENSMODP00000015449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]