SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015490 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015490
Domain Number 1 Region: 777-829
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000322
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 686-735
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000073
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 3 Region: 654-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000822
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015490
Domain Number - Region: 143-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00325
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number - Region: 267-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0611
Family Classic zinc finger, C2H2 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015490   Gene: ENSMODG00000012367   Transcript: ENSMODT00000015776
Sequence length 975
Comment pep:known_by_projection chromosome:BROADO5:1:428693526:428722749:-1 gene:ENSMODG00000012367 transcript:ENSMODT00000015776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQNYQSSNNTGSLDIMEDTSSVAVLVPGIGEQEAVLISETVISPSLEIGDEQRKYKTDP
LIDVIQKLSKIVESEKSQRCLLIGKKRSHPNASMLTLETQDLCEIPAKTIELPASGTKRT
EELQGDYYITDYFPQNNRKTMCYQCSLCKFLSSSLSVLKEHIKQHGQQNEVILMCSECHF
VSKSQEELEAHIVNYHGNDAKTPIESKVQQCTGLSNPSLQGTIEGNLKTVSDLTVNLDNN
DMQTIQAASVAEMGRRKWYTCEQYGMYRCLICSYTCGQQRMLKTHAWKHAGEVDCSYPIF
EEENDTLGLSDFSATTAQGVETVVLALEDDELGIHSGQSVQVQICSSEQLSCRSIEKNRE
VNESLRQSTTLDPNGEEMLEVMSDTEDSLMADSLLSSAQKIINCSPNKKGHVNVIVERLP
SAEETVLQKPFLMNTDMEEEKNLISTKTQIVREESDEVYKTDKSTVEIEEVIIGWSSPEK
KDNEIISNKVLAADENAPPGRRRTNSESLRLHSLAAEALVTMPIRAAELTRASLGHYGDV
NLLDPDTGQRQVENTIAAYSKLMSPLNSTEVLTSFNQSDSTLVELTEDKQELSEVPVKMG
ISMSLLTVIEKLRERTDQNASDDDILKELQDNAQCQSTGDSSLPGNSLVEFIPNADRPYR
CRLCHYTSGNKGYIKQHLRVHRQRQPYQCPICEHIADNSKDLESHMINHCKTRMYQCKQC
EESFHYKSQLRNHERERHTAPDNLSKVNSNEPVVSNEAAEGKCIREGTLFFLSSIQRLYK
CDVCDYTSTTYVGVRNHRRIHSSDKPYRCSLCGYVCSHPPSLKSHMWKHASDQNYNYEQV
NKAINDAISQSGRVQGQSLGKILSESTDEKANSVVGISENLVSFSETISQVPSEVIGTSE
NKKLNSAKNNTSQNSEKHPKQALHNMEYCVLLFCCCICGFESTSKENLLDHMKEHEGEII
NIILNKDHNATLNTN
Download sequence
Identical sequences F7DHM4
ENSMODP00000015490 ENSMODP00000015490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]