SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015542 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015542
Domain Number 1 Region: 697-941
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 580-657
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-25
Family Nuclear receptor 0.0000166
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015542
Domain Number - Region: 399-432
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015542   Gene: ENSMODG00000012412   Transcript: ENSMODT00000015829
Sequence length 943
Comment pep:known_by_projection chromosome:BROADO5:X:8100717:8307654:-1 gene:ENSMODG00000012412 transcript:ENSMODT00000015829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRVYPRPPAKTFRGAFQNLFQSVREVIQNPGVRHPGAAGGAAPPGARLQHQQQ
QQQQVPQQPQQQQSSPRQPQASVQPQQAPDDGSPPAPNRGPAGYLALEDDSQPQPSQAQP
PAEGCPENGCVPEPGPPAAGGKGLQQTAVAVAAPDDDDSAAPSTLSLLGPSFPGLSGCST
DLKDILAEAGTMQLLQQQQQHHHHQQHQHQQQQQQEAAVVADGGGGRAREGAGGSASSKD
NYLGGTSTISDSAKELCKAVSVSMGLGVEALEHLSPSEQLRGDCMYAQLLGGPAAAARPA
PSCAPLTDCKGSLLDDASAKGADEAADYPAFKGGYAKALDGDGLGCCGGSGGGGGGEAAA
AGQLEMPSALALYKAGSLDEAAAYQSRDYYNFQLALAGPPPPPPPPHPHARIKLENPLDY
GSAWAAAAAQCRYGDLASLAHGGGAAAAAAAAAAAAAAAGPGSGSPSAAAASSSWHTLFA
SEEGQLYGPCAGASAAGEAAPVAPYGYRGAQGLPGQEADYPPPEVWYPGGVVSRVPYPGP
GCVKSELGPWMEGYSGAYGDMRLDAARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTC
GSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGN
LKLQEEGEPSSSTSPNEDQGQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDS
FAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTN
VNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII
PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQF
TFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences F6PME3
ENSMODP00000015542 ENSMODP00000015542 13616.ENSMODP00000015542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]