SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015564 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015564
Domain Number 1 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.34e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.58e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.1e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 379-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.42e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 9 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-21
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 10 Region: 165-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000017
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015564   Gene: ENSMODG00000023632   Transcript: ENSMODT00000015852
Sequence length 647
Comment pep:novel chromosome:BROADO5:3:503010163:503036441:1 gene:ENSMODG00000023632 transcript:ENSMODT00000015852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELHQMDRLGVLCCLYREPRVPGMTFERDGLPAQEVVSFKDVAVDFTREEWRLLSPPQK
ELYKEVMLENARNLLSVGLSAPPEDMFSSLEQREAPWMLEKDDLRSCCPEGKMRPEMKTN
STEVSFSVEELDLEKFMSHGPNNFAFREFCVVPKNSSHIENQRMHTEEKSSVNNKCGKTF
MPRESLYRYQRIYTTDKPFECHQCGKAFSRSSNLAVHQRIHTGEKPYECQQCGKAFSCSH
SLAVHQRIHTGEKPYECKQCEKSFSCSSNLAVHQRIHTGEKPYGCKQCGKTFSRNSHLAL
HQRIHTGEKPYECKQCGKAFSCSSTLAVHQRIHTGEKPYECKQCGKAFSCSSTLAEHQRI
HTGEKRYACKQCGKAFSWNYLAPHQRIHTGEKPYECKQCGKAFSRISTLAVHHRIHTGEK
PYECKECGKAFTCSSTLAVHQRIHTGEKPYECKQCGKAFSRSSNLTVHRRIHTGENSYEC
KICGKRFSQRTYFTLHQRIHTGEGPYECQQCGKTFSQTSSLAEHHRSHTLEKPYECKECG
KAFSCSSALVVHQRIHTGEKPYECKHCGKAFSRSSNLAVHQRIHTGEKPYECKHCGKAFS
HSSHLAEHQRIHTGEKPYECKQCGKAFSRSSNLAVHQRIHIGEKSHE
Download sequence
Identical sequences F6PJY0
ENSMODP00000015564 XP_007490272.1.35504 XP_007490273.1.35504 XP_007490274.1.35504 XP_007490275.1.35504 ENSMODP00000015564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]