SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015588 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015588
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-27
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.26e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 57-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-23
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 6 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 275-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.23e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 377-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000314
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015588   Gene: ENSMODG00000028659   Transcript: ENSMODT00000015877
Sequence length 631
Comment pep:novel chromosome:BROADO5:3:503395887:503477691:-1 gene:ENSMODG00000028659 transcript:ENSMODT00000015877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTSRGRARSQLLEKSLVIFLDLCLGTHTGFLPPPEGPQGGEPAARGMPPDTPRPPSQG
SITFKDVAVDFTQEEWCLLDHSQKELYLEVMLENVQNLLSVGLPVPRENFISCFQQGKTP
CLVEEKDPRSFFPVEDVEVKEMSIKMSLFMEGSVSPKCMNEGPRDFILREICDSAVKANK
NPKSDCEFGESAEKFSQYSVLNQYVKLTAGNNCDQDSEYQQYFSEEVGLVQSSEKSMYQG
NMGQMAFGWSSDLIRHPKSKRVKMDSVSDNGGRPFNQNSELATHQRIYTRDIPYDYKHYG
NAFTEKGSLAKHQSIHTREKPYECKQCGKAFTQRSNLTVHQRIHTGEKPYECKQCGKTFT
QRSNLTVHQRIHTGEKPYKCKLCGKAFTASGDLVVHQSIHTGEKLYECKQCGKTFTKRNN
LTVHQRIHTGEKPYECKHCGKAFTVRINLATHQRIHTGEKPYECKHCGKAFTKRSCLAVH
QRIHTGEKPYECRQCGKAFTERGHLAVHQRIHTGEKPYECKHCGKAFPRRGSLGKHQRIH
TGEKPYECKHCGKAFRWFGFLSVHQRIHTGEKPYECKQCGKAFSQKGSLATHQRIHTGEK
PYSCKHCGRTFTQRGHLAAHQSIHTGEKRGQ
Download sequence
Identical sequences F6PI12
ENSMODP00000015588 ENSMODP00000015588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]