SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015589 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015589
Domain Number 1 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000108
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015589
Domain Number - Region: 584-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00445
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015589   Gene: ENSMODG00000012452   Transcript: ENSMODT00000015878
Sequence length 608
Comment pep:known_by_projection chromosome:BROADO5:2:200227134:200235342:1 gene:ENSMODG00000012452 transcript:ENSMODT00000015878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEDQQTSMAATAAVSPSEYLQPAASTAQDSQPSPLALLAATCSKIGPPAVEAAVAPPAP
PQPTPRKLVPIKPAPLPLSPGKNSFGILSSKGNILQVQGSQLGTSYPGGQLVFAIQNPTM
INKGARSSANIQYQAVPQIQAGSGQTIQVQPNLTNQIQIIPGTNQAIITPSPSSHKPVPI
KPAPIQKAGSGGMVKLTGSGGNVTLTLPVNNLVSTPDSGTPTQLLTESTPAPLVKPNKKM
RKKGVSTSSQPAVAVAEQVETVLIETTADNIIQAGNNLLIVQSPGGGQPAMVQQVQVVPP
KAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQDFQIQTPEPTPTQIYIRMPSGELQTI
LLQEPPSVTVPAASTTSSSSSPVARGPHLGGTSKKHSTAASRKERPLPKIAPAGGIISLN
AAQLAAAAQAMQPININGVQVQGVPFTFPNPGGQQQLTVQNVSGNNLTISGLSPTQIQLQ
MEQALAGEVQPGEKRRRMACTCPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAH
VRLHTGERPFVCNWVYCGKRFTRSDELQRHARTHTGLKRLERGRCQKRFMRSDHLTKHYK
THLVTKNL
Download sequence
Identical sequences F6PI08
ENSMODP00000015589 ENSMODP00000015589 13616.ENSMODP00000015589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]