SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015591 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015591
Domain Number 1 Region: 268-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000943
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 2 Region: 301-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000164
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015591   Gene: ENSMODG00000012454   Transcript: ENSMODT00000015880
Sequence length 383
Comment pep:known_by_projection chromosome:BROADO5:2:200127027:200128178:-1 gene:ENSMODG00000012454 transcript:ENSMODT00000015880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTAVCGSLGSQHTEAPRASPPRLDLQPLQTYQGHTSPETGDYPSPLQAGELQNLPLGPE
VDFSQGYELPGSSSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPSHPGTEDGSW
WDIHPGTSWMDLPHAQGTLASSGHPGALQAGLGGYVGDHQLCAPQPHTHPHHLLPAAGGQ
HLLGPPDGAKPLEATAPETHGLDASLDGAARPKGSRRSVPRSSGQAVCRCPNCLEAERLG
APCGPDGAKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDE
LQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGSKEEAAGTGAQCEGKSGAAAEP
PGGKGKREAEGGGGGSAGAALSN
Download sequence
Identical sequences F6PHU9
ENSMODP00000015591 XP_007482404.1.35504 XP_007482405.1.35504 XP_007482406.1.35504 XP_007482407.1.35504 XP_016286006.1.35504 ENSMODP00000015591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]