SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015601 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015601
Domain Number 1 Region: 158-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.41e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 554-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.27e-23
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 493-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.19e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 102-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.36e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 7 Region: 420-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 47-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 1-47
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000485
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000558
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015601   Gene: ENSMODG00000012463   Transcript: ENSMODT00000015890
Sequence length 626
Comment pep:novel chromosome:BROADO5:4:401195708:401197881:1 gene:ENSMODG00000012463 transcript:ENSMODT00000015890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKIHMGEKLFKCTKCGKAFCYKSLLTGHQRIHTGEKSYESNKCGKIFTESFKRAACQQIH
IGEKPYKCHQCEKTFTRNYTLAEHLKIHRGEKSYECKQCGKAFRHCSSLCKHWKIHTGEK
PHECNQCGKVFVESSKLIIHQRIHTGEKPYECKQCGKAFTQSSSLAKHERIHTGEKPYEC
NNCEKAFSDSSTLAKHKRIHTGEKPYECKECRKAFRHCSSLRNHLKIHIGKNPHERNQCK
EVFIKSSDLAAHQIIHPGENLYEYYYSGKAFTETSKLVKNQRIQTGEKTYACIRCRKAFR
HSSSLWNHLKIHTGEKPYECNLCKKTFTDSSILVEHQREKPYECNQCGKAFRHCSSLRKH
QKIHTGEKPYECNQCGKVFAESSKLVIHQRIHTGEKPYECSNCKRAFTQSSSLTKHERIH
TGEKPYECNNCGKAFTDSSSLVKHQRIHTGEKPYECKQCRKTFRHCSSLCNHIKIHTAKK
LYECNQCRRLSQTSSKLVAHPKIHTGEKPYKCHQCEKAFTQSYTLAEHMKIHTGEKPYEC
NQCGKAFRHCSSLQSSKLVIHQRIHTGEKPYECSNCKRAFTQSSSLTKHERIHIGEKPYV
CNQCGKAFRHCSSLHNHLEIHIGEKL
Download sequence
Identical sequences F6Q4R0
ENSMODP00000015601 ENSMODP00000015601 13616.ENSMODP00000015601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]