SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015647 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015647
Domain Number 1 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 511-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.75e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 762-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 707-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 33-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 650-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 804-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.37e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 12 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-20
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 13 Region: 195-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000326
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 14 Region: 557-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000123
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015647   Gene: ENSMODG00000023861   Transcript: ENSMODT00000015936
Sequence length 882
Comment pep:novel chromosome:BROADO5:3:464444015:464473201:-1 gene:ENSMODG00000023861 transcript:ENSMODT00000015936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELHQMASRGLLCCLYREPAVPGMAFERDRLSAQEVVTFKDVAVDFTREEWCLLSPPQK
ELYKEVMLENAQNLLSVGLLGPPEDVISYLEQKEAPWMLEQEDLRGCCRGFHLLDKFQFE
IFQSLLIVSILGEGEIRSEMKVNKTEMSPSMEEMDLQRFKSDGPNNFAFKEFGVAPQNSS
HLEEQRMHSEEKCSEHNKCRMMFMHRTGLAGYQKIHTGERPYECKQCGKTFSRSSSLVVH
QRTHTGEKPYECKQCGKPFSRRSSLAGHQRTHTGEKPYECKHCGRTFRQSSKLAVHQRVH
TGERPYECKQCGKTFSQQSHLAIHQRIHTGEKPYECKQCGKTFTVKSSLAVHQRIHTGVK
PYECKQCGKAFSQRSHLVIHQRIHTGEKPYECKQCGKTFRRSYTLAVHQRIHTGEKPYEC
KQCGKIFSWSSNLAGHQRVHTGERPYECKQCGKTFKERSILAGHQRVHTGERPYECKQCG
KAFSQRSHLALHQRIHTGEKPYECKQCGKKFTMKSSLAVHQRIHTGVKPYECKQCGKAFS
QKSHLVIHQRIHTGEKPYECKQCGKTFCRSYSLAVHQRTHTGEKPCECKQCGKTFRLSFS
LGVHQRIHTGERPYEGKQCAKTFKERSILAGHQRVHTGEKPYECKQCGKTFKKRSILAGH
QRTHTGEKNYECNQCGKTFTMKHSLGVHRRIHTGEKLYKCKQCGKKFHQRYDVAIHQRIH
TGEKPYECKQCGKTFTVKSSLAVHQRIHTGVKPYECKQCGKAFSQRSHLVIHQRIHTGEK
PYECKQCGKTFRRSYTLAVHQRIHTGERPYECKQCGKTFKERSILAGHQRIHTGEKPYEC
KQCGKAFHQSSNLAVHQRIHMGRKLKNTSYMERSSHLAPDLL
Download sequence
Identical sequences F6Q236
ENSMODP00000015647 ENSMODP00000015647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]