SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015780 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015780
Domain Number 1 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.03e-27
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 231-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.79e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.18e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 173-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 551-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-20
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 10 Region: 137-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015780   Gene: ENSMODG00000025177   Transcript: ENSMODT00000016070
Sequence length 608
Comment pep:novel chromosome:BROADO5:7:64662080:64691265:-1 gene:ENSMODG00000025177 transcript:ENSMODT00000016070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVTFKDVAVDFTREEWRLLSPPQKELYKEVMLENARSLLSVGLPAPPEDVISYLEQRE
APWMLKQEGLRSCCPEDEIRLDMKVTTTEVSFSVDETEKQKFMSGGPDNLACREFCVEFQ
NASLPEHQKMKSEKTSHECNQCGKTFMHRASLAGHQRIHTGKKLYACKQCGKTFSQMFSL
TGHQRIHTGEKPYDWKQRGKTFNQNSNLGLHQRIHTGEKPYECKQCGKTSSRKSDLTVHQ
RIHTGEKPYECKQCGKTFSRSSHLAVHQRIHTGEKPYECNQCRKTFICSSNLAAHQRVHT
GEKPFECKQCQKTFSQNSKLALHQRIHTGEKPYECKQCGKTFRQRCGLAVHQRIHTGEKP
YDCKQCGRTFSQSSSLANHQRIHTGQKPYECKQCGKTFSLSSSLANHQRTHTGEKPYECK
QCRKTFNCNSHLAAHQRIHTGEKPYECKQCGKTFSFSSNLANHQRIHTGEKPYECKQCGK
TFSQRYNLVVHQRIHTGEKPYECKECGKTFSDRSCVAVHQRVHTGEKPYECKQCGKTFRL
NSKLAEHQRIHTGEKPYECKQCGKTFNCSSNFRVHQRIHTAEKPYECKYCGKIFSWSSSL
AVHQRIHV
Download sequence
Identical sequences F6S2S1
ENSMODP00000015780 XP_007501472.1.35504 ENSMODP00000015780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]