SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015784 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015784
Domain Number 1 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-27
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.68e-27
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-25
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 437-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-22
Family KRAB domain (Kruppel-associated box) 0.00079
Further Details:      
 
Domain Number 7 Region: 262-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.54e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 651-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 312-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000467
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 181-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000124
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 485-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000361
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 12 Region: 401-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000239
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015784   Gene: ENSMODG00000012616   Transcript: ENSMODT00000016074
Sequence length 705
Comment pep:novel chromosome:BROADO5:4:411379007:411385073:-1 gene:ENSMODG00000012616 transcript:ENSMODT00000016074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QESVTFKDVAVDFTQEEWCLLDPSQKALYKDVMLETSQNLLSLGLPGAKADLISQLNQEE
AWMLKEEDPRNSSLCKEIWNWESNLEKKQGNWDSHSRPLKINFRKTSSKGRDEECNKFQR
SFSPELDLTLSVQQTVPTGKILCEYDDSGRNIRQYSDLIQFKKITSGNRYSKYNEYREKP
QSSTLSSHQKIHSGEKLYKCNHCGKAFRQSSNLAVHQRIHTGERPYKCNECGKTFRQSST
LMTHHRVHSGEKPNRCNECGKAFSQSSSLIAHRRIHTGEKPYICSECGKAFCHSSSLIAH
RRIHSGEKLIPSGEKPYICNECGKVFRWKAKLVVHERIHTGEKPYECNQCGKAFRQSSKL
AVHQRIHTEEKLYQCNECGKAFSQNSSLIAHQRIHSGEKLYKCNQCGKTFRKPSRLVAHQ
GIHTGEASYKCNDCGKAFSDNSSLTAHKVIHTGEKPYKCSQCGKAFRQSCNLAVHQRIHT
REKRYKCKECGKVFGERSSLIGHQKIHSGEKPYKCKECGNAFRQSSSLIAHQRIHTGEKP
YKCNECGKAFSRSSSFIAHQRIHTGEKPYKCNECGNAFSHSSSLIAHQRIHTGEKPFKCN
ECGKSFSHISSLIAHQRIHTGEKPFKCNECGKCFSQKSSLIVHQRIHSGEKPYKCDQCVK
AFINASKLSVHKRIHTGEKPYKCNECGKAFSRSANLIVHQRTHSG
Download sequence
Identical sequences F6S2P5
ENSMODP00000015784 ENSMODP00000015784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]