SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015868 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015868
Domain Number 1 Region: 68-174
Classification Level Classification E-value
Superfamily POZ domain 5.3e-22
Family BTB/POZ domain 0.0025
Further Details:      
 
Domain Number 2 Region: 565-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-17
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 672-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000238
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 602-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000864
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 363-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000668
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 6 Region: 522-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000486
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 468-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000233
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 8 Region: 709-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000136
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015868
Domain Number - Region: 206-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00282
Family Classic zinc finger, C2H2 0.052
Further Details:      
 
Domain Number - Region: 425-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00573
Family Classic zinc finger, C2H2 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015868   Gene: ENSMODG00000012684   Transcript: ENSMODT00000016160
Sequence length 913
Comment pep:known_by_projection chromosome:BROADO5:2:97512311:97572997:-1 gene:ENSMODG00000012684 transcript:ENSMODT00000016160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRRKVTANFDEKIHLGYHKDSSDGNSAADSDQVTFSHSIEGSAPEDLQCYQQLPPSPD
QRKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSK
NPSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKNEIPLVLEAAKFLDIIDAVKLLNNENN
SNFPSEITEKASPAETLSELAGRLSNSHQCKFCSRNFCYKKSLENHLTKTHRSLLIGKKH
GLKMLERGFSARRSTRNRKCPVKFDEDSDNDNESDEIDNLDKDNLDKVTFDTEKSDKNDS
EDAGSEYNADAEAQEEEISDDYSEGEEQSDKEHNNTEEDPEIADSAGNIHEGLTPVVIQN
SNKKILQCPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVHRKKHSNET
EFHKKEHKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIKKTKSESWKCDICKKSFTRR
PHLEEHMILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKR
HIECTHGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLR
VHHDDKRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYKSVHL
GEKVWQKYKATFHQCDVCKKIFKGKSSLEMHFRTHSGEKPYKCQICNQSFRIKKTLTKHM
VIHSDARPFNCQHCNATFKRKDKLKYHIDHVHGIKSPDEPLTSSEEKLVSLPMEYPPDGK
GYQTETKQYMDQPKYQSESKTMLPNVPNEVCVPVTLVPVQMPDTQNDLVRHTTALPPPSQ
GILSTQPQPTDYPRTTDLAFLEKYTLTPQPTNIVHPVRPEQMLDPRDQSYLGTLLGLDNT
TAVQNIANNERHS
Download sequence
Identical sequences F6VG42
ENSMODP00000015868 XP_001367648.1.35504 ENSMODP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]