SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015940 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015940
Domain Number 1 Region: 391-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 2 Region: 237-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000882
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 366-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000919
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 340-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000356
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 275-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000117
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 210-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000014
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015940
Domain Number - Region: 2-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00222
Family Classic zinc finger, C2H2 0.065
Further Details:      
 
Domain Number - Region: 323-335
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0254
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 83-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0303
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015940   Gene: ENSMODG00000012745   Transcript: ENSMODT00000016234
Sequence length 574
Comment pep:known_by_projection chromosome:BROADO5:Un:67060640:67062361:1 gene:ENSMODG00000012745 transcript:ENSMODT00000016234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQYICSACGLLYDTLEEVFLHQQQHQCPAEPPAAGGPLSEESHFQCLECTELLLSPEELL
AHQDAHTQDTNPPIGPLQGQVQYHCGNCEELFLSPDLWLAHCEACPTPEESETLLPSPAA
TMDPYECPECAQLLDTPEEFLEHQGTHFASLEKEEADGGEDEEEPCAEGTVVEEEKAPHI
HQCSDGKGTQGSEEELRRPRRVAHTPTTTLHRCAQCHRGFTSANRLLAHGRAHIGGTHEC
PACSKVFKKAASLEQHLRLHRGEARYLCVDCGRGFGTELTLVAHRRAHTANPLHRCPCGK
TFSNMTKFLYHRRTHAGKSGAPPPPPPAPPPPPPPPAALSCPHCAKAFSSAARLARHRRA
VHSPPERRHRCGVCGRGFKKLVHVRNHLRTHTGERPFQCHACGKTFASLANLSRHQLTHT
GARPYPCPDCGKRFTQSSNLQQHRLLHGRSAAFSRASRLQARLATVRNLYGKGTASSGTL
SRAGLRHPPRGHTGRDEPRPSPRPAAPPMPSAPAPQQTIMCTELGETIAIIETSQPLALA
DTLQLCQVALGAGGLHLGGTGGAGELLHLDAAFV
Download sequence
Identical sequences H9H6L2
ENSMODP00000015940 ENSMODP00000015940 13616.ENSMODP00000015940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]