SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015993 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015993
Domain Number 1 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.21e-24
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 5 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 6 Region: 54-113
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.41e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 7 Region: 507-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 211-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000017
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015993   Gene: ENSMODG00000012767   Transcript: ENSMODT00000016288
Sequence length 566
Comment pep:novel chromosome:BROADO5:3:526340408:526353558:1 gene:ENSMODG00000012767 transcript:ENSMODT00000016288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKLRLFVEGSGVQRCMNEVPHDCILREICDSDMQNLPSHSESTSHLHGENHFKGSLTF
KDIAVDFTQEEWCLLDHTQKELYLEVMLENVQNLFSVGLPVPREYCTSCFQQGKVPWQLE
PKGSRSSCPGDQCSVFNQYMKVTSGNDYCQNSQYSKFFPEEVGLFQLNEKPSEKPMYQGN
QGGMAFSYNLDFIRHKKSKWVEMVSVQNEVEKPFRQNSDLAPDQIIHSREKTYKCKQCGK
AFKQKGSLEVHHRIHSGEKPYECKHCGKAFTERGSLTRHQLIHSGEKPYECKHCGKAFTQ
RSHLAAHQRIHTGEKPYECKQCGKAFMQSHYLAAHQRIHTGEKPYECKQCGKAFTQSSTL
AAHQRIHAGEKPFECKECGNTFKGRRSLAKHQRIHTGEKPYECKQCGKAFTQSSSLAAHQ
RIHTGEKPFECKECGKTFIERRSLAKHQRIHTGEKPYECKQCGKSFTYSSSLATHQLIHT
GEKPHECKQCGKAFVHSSSLASHQRIHTGEKPYECKQCGKAFVHRSSLASHQRIHTGEKP
YECKQCRKTFTHRNSLAMHQLIHNGE
Download sequence
Identical sequences F6S0W1
ENSMODP00000015993 ENSMODP00000015993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]