SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016067 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016067
Domain Number 1 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 272-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000011
Family Classic zinc finger, C2H2 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016067   Gene: ENSMODG00000012840   Transcript: ENSMODT00000016364
Sequence length 857
Comment pep:known_by_projection chromosome:BROADO5:2:101647857:101650664:-1 gene:ENSMODG00000012840 transcript:ENSMODT00000016364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGSGFLSSGGGGSGSSSSGGGGGGGGGGSSGAGSSRRAEMEPTFPPTAEPPPPPPPAP
DMTFKKEPAAPAAAYPPQRNSWGFLQSLVSIKQEKPTDPEEQQHHHHHHHYGGLFAGAEE
RPPGLGGGEGGSHGVIQDLSLLHQHGQHPPPQHHRDVLLSSSRTDDHHGNEEPKQDTNVK
KAKRPKPESQGIKAKRKPSASSKPSLVGDGEGAILSPSQKPHICEHCSAAFRSSYHLRRH
VLIHTGERPFQCSQCSMGFIQKYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTH
SGEKPYKCDTCQQYFSRTDRLLKHRRTCGEAIAKGAASAEPGSSNHNSMGNLTVLSQGNT
SSSRRKNKSKSLSIENKEHKTGKGNESQIANNINMQSYSVEIPIVSSSGGIIGAGIDELQ
KRVPKLVFKKGSRKNTDKNYLNFVSPLPDIVGQKSLSGKPSGSLGIVSNSSVEAISLLQS
AGGKQGQISSNYDDAMQFSKKRRYLQTASGNSAFSINVGHMASQQSVIQSAGVSVMDNEA
PLSLIDSSSLNTEIKSCHDKSGIPDEVLQSLLDQYSSKSEGQKEDPFNITEQRVDLHPSG
EHSDMVQEENLSPGNQTPSNDKANMLQGYSKYIQQAFERSANSTGFAFGPSFQFVSLSST
LHNHTLFPDKQIYTTSPLECGFSQSVTSVLPTTLPKPPFGMLLGSQPGFYLSALEATHQQ
LTPSQELDDLIDPQKSLETSSSYQSTSQKLTSQKEQKNLESSTSFQIPSQELTSQIDPQK
DIEPRTTYQIENFAQAFGSQFKSGSRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDV
SEPCSTRVKTPTSQSYR
Download sequence
Identical sequences F7CTL3
ENSMODP00000016067 13616.ENSMODP00000016067 ENSMODP00000016067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]