SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016121 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016121
Domain Number 1 Region: 98-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 154-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-24
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 42-99
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 4-56
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 284-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 201-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000375
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016121   Gene: ENSMODG00000003094   Transcript: ENSMODT00000016419
Sequence length 344
Comment pep:novel chromosome:BROADO5:3:501021399:501022433:1 gene:ENSMODG00000003094 transcript:ENSMODT00000016419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGEKPYKCNECGKAFRQSSQLIVHHRIHTGEKPYECNECGKAFRESKELIRHQRIHTGEK
PYECKECGKGFRESKELTRHQRIHTGEKPYECKDCGKAFRRRTGLNEHQRIHTGEKPYEC
NECGKAFRRRTGLNEHQRIHTGEKPYECNECGKAFRESKELIQHQRIHTGEKPYECKECG
KAFRRSTGLTDHQRIHTGEKPYECNQCGKTFRWRTELTSHHTIHTGEKPYECSECGKAFR
LSAHLIQHRSIHTGEKPYECNVCGKAFRWITGLASHHRIHTGEKPYECNICGKTFRQSTQ
LSRHHRMHTGEKPYECTECGKAFCLSTQLIQHQRIHNRMKPFEW
Download sequence
Identical sequences F6Z1B7
13616.ENSMODP00000016121 ENSMODP00000016121 ENSMODP00000016121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]