SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016140 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016140
Domain Number 1 Region: 136-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 2 Region: 173-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000364
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 456-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000595
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016140
Domain Number - Region: 111-145
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0349
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016140   Gene: ENSMODG00000012901   Transcript: ENSMODT00000016439
Sequence length 514
Comment pep:known_by_projection chromosome:BROADO5:2:197920112:198011356:1 gene:ENSMODG00000012901 transcript:ENSMODT00000016439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTQSTVELRNSQAQPVFTEGQVILNDYSSSKPQEVENMDSGEENKDQVPPVEDEDMGD
DSMKVKDEYSERDENTLKPDPMENAEDPEIPYSYPREYNEYESIKLERHAVSYDSSRPTS
GKMNCDVCGLACISFNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHTGEKPFK
CHLCNYACQRRDALTGHLRTHSVEKPYKCEFCGRSYKQRSSLEEHKERCRTFLQNTGMGD
TASVEARHLKAEMGTERALVLDRLATNVAKRKSSMPQKFIGEKRHCFEVNYNSSYMYEKE
SEMIQSRMMDQAINNAITYLGAEALRPLVQTPPAPTSEMVPVISSMYPIALTRTELPNGG
PQDLEKKSAHLSDKCLPSERGLSPNNSGHDSTDTDSNHEERQNHAYQQNHLIPPRARNGM
PTLKELPHSYELLKPPSICPRDTIKVINKDGEVMGVYRCDHCRVLFLDYVMFTIHMGCHG
FRDPFECNMCGYRSHDRYEFSSHIARGEHRVMLK
Download sequence
Identical sequences F7GKY0
XP_007482359.1.35504 ENSMODP00000016140 ENSMODP00000016140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]