SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016248 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016248
Domain Number 1 Region: 404-467
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000136
Family C-terminal fragment of elongation factor SelB 0.072
Further Details:      
 
Domain Number 2 Region: 26-36
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000133
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016248
Domain Number - Region: 179-338
Classification Level Classification E-value
Superfamily TPR-like 0.000759
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016248   Gene: ENSMODG00000012989   Transcript: ENSMODT00000016548
Sequence length 540
Comment pep:known_by_projection chromosome:BROADO5:2:197581861:197591371:-1 gene:ENSMODG00000012989 transcript:ENSMODT00000016548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQEGSARRRGADKAKQPPGGGEQEPPPPPPPPPPPAAPLDVEMKEEAAAAAGGAAGEGE
GKVASGERSQRELDTVTLEDIKEHVKQLEKAVSGKEPRFVLRALRMLPSTSRRLNPYVLY
KAVIGFFTSNNVTRDFLLAFLEEPMDTEVDLQFRPRTGKAASAPLLPEVDAYLQLLMVIF
LMNSKRYKEAQKVSDDLMQKISTQNRRALDLVAAKCYYYHARVYEFLDKLDVVRSFLHAR
LRTATLRHDADGQATLLNLLLRNYLHYSLYDQAEKLVSKSVFPEQANNNEWARYLYYTGR
IKAIQLEYSEARRTMTNALRKAPQHTAVGFKQTVHKLLIVVELLLGEIPDRLQFRQPSLK
RSLMPYFLLTQAVRTGNLAKFNLVLDQFGEKFQADGTYTLIIRLRHNVIKTGVRMISLSY
SRISLADIAQKLQLDSPEDAEFIVAKAIRDGVIEASINHEKGYVQSKEMIDIYSTREPQL
AFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQQDLEFAKEMAEDDDDSFP
Download sequence
Identical sequences F7CS51
ENSMODP00000016248 ENSMODP00000016248 XP_001366018.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]