SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016424 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016424
Domain Number 1 Region: 339-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-20
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 
Domain Number 2 Region: 301-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000287
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 3 Region: 383-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000637
Family Classic zinc finger, C2H2 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016424   Gene: ENSMODG00000013124   Transcript: ENSMODT00000016726
Sequence length 420
Comment pep:known_by_projection chromosome:BROADO5:1:318625138:318658458:-1 gene:ENSMODG00000013124 transcript:ENSMODT00000016726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEDDEEDDEDGAGGGGG
GGGGHSGHHHHHHHHHHHHHHPPMIALQPLVTDDPSQVHHHQEVILVQTREEVVGGDDSD
GLRAEDGFEDQILIPVPAPAGGEEDYIEQTLVTAAAAGKSGGGSSSSGGGRMKKGGGGGK
KSGKKSYLSSGGGGAGGGGGVGGAEPSGRKWEQKQVQIKTLEGEFSVTMWASDDKKDIDH
ETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPR
TIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQ
CTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
Download sequence
Identical sequences F7BM88
ENSMODP00000016424 ENSMODP00000016424 XP_016286756.1.35504 13616.ENSMODP00000016424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]