SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016426 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016426
Domain Number 1 Region: 608-985
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.44e-102
Family Formin homology 2 domain (FH2 domain) 0.00000254
Further Details:      
 
Domain Number 2 Region: 49-418
Classification Level Classification E-value
Superfamily ARM repeat 9.95e-99
Family Diap1 N-terninal region-like 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016426   Gene: ENSMODG00000013125   Transcript: ENSMODT00000016728
Sequence length 998
Comment pep:known_by_projection chromosome:BROADO5:2:281060084:281213022:1 gene:ENSMODG00000013125 transcript:ENSMODT00000016728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWKRSRHGLGFLCCFGGNDIPEINLRENHPLQFIEFSAPMPPAEELNARFAELVDELD
LTDKNREAMFALPLEKKWQIYCSKKKEQEDPNKLATSWPDYYIDRINSMAAMQTLYVFDE
EETEMRNKVVEDLKTALRTQPMRFVTRFIELDGLTCLLNFLRSMDHATCESRIHTSLIGC
IKALMNNSQGRAHVLAQPEGISTIAQSLRTENCKTKVAVLEILGAVCLVPGGHKKVLQAM
LHYQVYAAERTRFQTLLNELDRSMGRYRDEVNLKTAIMSFINAVLNAGAGEDNLEFRLHL
RYEFLMLGIQPVIDKLRRHENATLDKHLDFFEMVRNEDDLELARRFDMVHIDTKSASQMF
DLIHRKLKHTEAYPYLLSMLQHCLQLPYKRNGGSIYHWQLLDRILQQIVLQDERGVDPDL
APLENFNVKNIIKMLVNENEVNQWREQAEKFRKEHAELVSRLERKERECETKTMEKDEMM
KTLNKMKDKLARESQELRQARGQLAELVAQLREFSTTGTVSSPPPPGGPLSLPSMTSIDL
PPPPPPLPFSCSPPPPPPPPPPGGPPPPPGAPPCFGMGMPPPLASLPSSCPPLRKKSIPQ
PSHPLKSFNWVKLNEERISDTVWNEIDDLRVFQVLDLEDLEKMFSAYQRHQKEMGSTEDL
YLTTRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRRAVLKMDEEEDLAKDMLEQLLKFI
PEKSDVDLLEEHKHEIDRMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAETKPKVE
ALLLASRELTRSRQLKRLLEVVLAIGNYMNKGQRGGAYGFRVSSLNKIADTKSSIDRNIS
LLHYLIMILEKNFPDILNIPAELQHLPEAAKVNLSELEKEINNIRKGLRAVEVELEYQKH
QKRESGDKFIPIMSDFITVASFSFSELEDQLNEARDKFARALKHFGEPEGKMQPDEFFGI
FDTFPTAFSEAQQDLDTMRRKKEREEXXXXXXXXXXXX
Download sequence
Identical sequences F7BM80
ENSMODP00000016426 ENSMODP00000016426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]