SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016615 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016615
Domain Number 1 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 380-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 44-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.63e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 604-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 660-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.02e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 325-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 11 Region: 100-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.4e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 13 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 14 Region: 716-772
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016615   Gene: ENSMODG00000023426   Transcript: ENSMODT00000016920
Sequence length 773
Comment pep:novel chromosome:BROADO5:4:412379803:412382286:1 gene:ENSMODG00000023426 transcript:ENSMODT00000016920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHSGEKPYECKQCGKTFTWRVSLATHERIHTGEKPYECKQCGKTFRQRSHLAVHQSIHTG
EKPYACKQCGKTFTRRVSLARHERIHTGEKPYECKQCGKTFRLRSHLSYHQSVHKGEKPY
ACKQCGKAFTERRYLVAHERIHTGEKPYECKQCGKTFRRKSHLANHQSIHTGEKPYACKQ
CGKAFRERSYLVAHQRIHTGEKCYECKQCGKTFRWRDSLTLHERIHTGEKPYECKQCGKT
FRRKSNLSYHESIHTGEKPYACKQCGNAFKERSYLVAHQRIHTGEKPYECKQCGKTFNRR
SHLANHQRIHTGEKPYACKECGKGFKERTYLVAHQRIHTGEKPYECKQCGKTFRQRYHLA
VHQSIHTGEKRYECKQCGKAFTQSAHLVLHQRIHTGEKPYECTQCGKTFTRRRSLIDHQR
IHSGEKPYKCTQCGKAFTERRGFIKHQSIHTGEKPHECKQCGKAFTQRRCLIRHQRIHTG
EKPYECKQCGKAFTDRPSLASHQRIHTAEKPYECKQCGKNFRWRISVVIHERIHTGAKPY
ECTQCGKAFTQRGSLVIHERSHTGEKPFECKQCGKAFTDRRSLASHLRIHTGEKPYECTQ
CRKAFTTRGSLNKHQIIHTGEKPYECTQCGKTFTQRSNLAKHQSIHTGEKPFECKQCGKA
FTERSSLASHLSIHTGEKPYECTQCGKGFTMRGSLNKHQIIHTGERPYECTQCGKAFIRR
SHLANHQSIHTGGKSYECKQCGKAFTQRGISLVTHERIHTGEKLYECKQCGKA
Download sequence
Identical sequences F7A9Y4
ENSMODP00000016615 13616.ENSMODP00000016615 ENSMODP00000016615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]