SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016709 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016709
Domain Number 1 Region: 328-393
Classification Level Classification E-value
Superfamily RING/U-box 3.33e-21
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016709
Domain Number - Region: 59-67,118-132
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016709   Gene: ENSMODG00000013364   Transcript: ENSMODT00000017019
Sequence length 651
Comment pep:known_by_projection chromosome:BROADO5:1:447256876:447321095:-1 gene:ENSMODG00000013364 transcript:ENSMODT00000017019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLFLERFPWPSLRTYTGLSGLALLGTIVSAYRALSLSEPGPSAGPGEPEALTSSQQPP
PPQPPPPSAPPGPGGPRARDVAQYLLSDSLFVWVLVNTACCFLMLVAKLIQCVVFGPLRV
SERQHLKDKFWNFIFYKFIFIFGVLNVQTVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYL
SFSPTTPMSSHIRVLTLLIAMLLSCCGLAVVCCVTGYTHGMHTLAFMAAESLLVTVRTAH
VILRYVIHLWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHMLLFGNIWLSMASL
VIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQSAR
KLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRIREDQQGENLDENLVPVAAAEGR
PRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVP
YHLVLQDLQLTRSVEITTDNILEGRIQVPFPAQRPDSLRPALNNSAERSSGDQEENEISA
QVERGPLDLSPRLEEMSDLSEVEAEPNEVEDFEARGSRFSKSADERQRMLVQRKDDLLQQ
ARKRYLNKTSDDDPASESCLLSESPSSDPVTQRRRMLAAAAERRLQMQQNS
Download sequence
Identical sequences F7DTS8
XP_001364690.1.35504 ENSMODP00000016709 ENSMODP00000016709 13616.ENSMODP00000016709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]