SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016853 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016853
Domain Number 1 Region: 3426-3568
Classification Level Classification E-value
Superfamily SET domain 1.18e-47
Family Histone lysine methyltransferases 0.0049
Further Details:      
 
Domain Number 2 Region: 1066-1136
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000133
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1166-1234
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000126
Family PHD domain 0.0085
Further Details:      
 
Domain Number 4 Region: 1304-1367
Classification Level Classification E-value
Superfamily Bromodomain 0.0000157
Family Bromodomain 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016853
Domain Number - Region: 925-934
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000251
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 1027-1079
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00082
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016853   Gene: ENSMODG00000013474   Transcript: ENSMODT00000017166
Sequence length 3571
Comment pep:known_by_projection chromosome:BROADO5:4:231524583:231605279:-1 gene:ENSMODG00000013474 transcript:ENSMODT00000017166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSRFSATSCGSSEKSSAASQHSS
QMSSDSSRSSSPSVDTSTDSQASEEMQALSEERSNTPDVHAPIPISQSPENDNSDRRSRR
FSISERSFGSRASKKLSALQSAPQQQTSSSPPPPLLTPPPPLQPASSIPDHTPWLMPPTI
PLASPFLPASAAPIQEKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDN
FRPPPLTPEDVGFASGFSASGSTAPAQLFSALHSGTRFDMHKRSPLLRAPRFTPSEAHSR
IFESVTLPSNRTSAGTSSTGVSNRKRKRRVFSPIRSEPRSPSHSMRTRSGRLSTSELSPL
TPPSSVSSSLSISVSPLATSALNPTFAFPSHSLTQSGESSEKNQRPRKQTSTPAEPFSSS
SPTPLFPWFTHTSQTERGRNKDRATEELSKERDVDKSMEKDKNRERDREREKENKRESRK
EKRKKGSEIQSSSALFPIGRVSKEKVVEDVATSSSAKKAAGRKKSSSLDPGTDIATVALG
DTTAVKTKILVKKGKGSLDKNNLDLAPAAPSLEKEKALCLSASSSSTVKHSTSSIGSMLA
QADKLPVADKRVASLLRKAKAQLYKIEKSKTLKQADQPKAQGQESDSSETSVRGPRIKHV
CRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKP
IKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKM
RKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKESNVVKNLVDPSQKTTPAREDHAPK
KSSEPPPRKPVEEKNEDGNVSAPGADSKQSSTSARKTGKQASQPVQVIPPQPPSTASLKK
EAPKTTPNEPKKKQQPPPPPPPPPPPPPPPPPPPPESVPEQSKPKKVAPRPSIPVKQKPK
EKEKPPPVSKQENGTLNLLNTLSNGNSSKQKLPADGVHRIRVDFKEDCEVENVWEMGGLG
ILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKF
CHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTP
GKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCEN
LSDEMYEILSNLPESVAYTCVNCTVRHPAEWRLALEKELQISLKQVLTALLNSRTTSHLL
RYRQAAKPPDLNPETEESIPSRSSPEGPDPPILTEVSKQEEQLPLDLEGVKRKMDQGSYT
SVLEFSDDIVKIIQAAINSDGGQPEVKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNK
VTSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPIPL
HPPTPPILNTDRSREDSPELNPPPGVEDNRQCALCLTYGDDNANDAGRLLYIGQNEWTHV
NCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEYCQKPGATVGCCLTSCTSNYHFMCSRA
KNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVLRRVFVDFEGISLRRKFLSGLEPENIHM
MIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIVECRPPVVEP
DINSTVEHDENRTIAHSPTSLTEIPPRDILNTAEMINPPSPDRPPHSHTSSSCFYHVISK
APRIRMPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLS
PQRSKFRIMSPMRAGNSYSHHSVSSISGIGVSTDHDSSIKTIDHFLGSLNPSTPNTLGQN
TSSSSQRTLVTVGTKATNVDGPPPSEMKHISVADLSSKSSSLKGEKSKMLNSKGSEGSTH
ILAYPKPVPQAHNTMSGEVNVSKMGTFVEPSSVSFSSKEALSFPPLPLRGQKKERDQHTN
SSQPENPSPGEDTETKALKTPGMNSRSIANEQITSSSRDRRQKGKKSGKESFKEKHSIKS
FLDPGQVMAGEEGSLKPEFVNQILTSEHISQRSCNNISSEKSGDKILPISGGIKAPSVQL
EGPAKESQTSRKRTVKVTLTPLKMESESPSKNTLKEIIPGSPSQGMESATLAESSSTSES
PGDGSVAQPSPNDPSSQESQSNTYSNLPVQDRNLMLQDGTKPQEDSSYKRRYPRRSARAR
SNMFFGLTPLYGVRSYGEEDIPFFSSSSGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNF
TRTVISSSGEERLGSHNLFREEEQCELPKISQLDGVDDGTESDTSVTTTARKVSQLPKRN
GKENGTENLKLDRPEDSGEKEHVIKSSSGHKTNEPKIDNCHSVSRVKTQGQDSLEAQLSS
LESGRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQAL
GESPESSSSELLTLGEGLGLDSNRGKDMGLFEVFSQQLPTAEPVDSSVSSSISAEEQFEL
PLELPSDLSVLTTRSPTVPSQNPNRLAVISDTGEKRVTITEKSVASTESDSALLSPGVDP
TPEGHMTPDHFIQGHMDTDHIASPPCGSVEQGHGNNQDLTRNSNTPSLQVPVSPTVPLQN
QKYVPSSTDSPGPSQISNAAVQTTPPHMKPATEKLLVVNQNMQPLYVLQTLPNGVTQKIQ
LTPSVSSAPNVMETNTSVLGPMGSGLTLATGLNPSLPTSQSLFPSASKGLLPMTHHQHLH
SFPAATQSSFPPNINNPTSSLLIGVQPPPDPQLLVSETNQRTDLNTTATNPPPGLKKRPI
SRLHSRKNKKLAPSSTSSSIAPSDMVSNMTLINFTPSQLSNHPNLLDLGTLGNTTSHRTV
PNIIKRSKSGIMYFEQAPLLPQSVGGAASSAVGASTIGPDTSHLTAGPVSGLASGSSVLN
VVSMQATTAPTTGGSVPGHVLGQGSVTLTSPRLLGAPDIGSISNLLIKASQQSLGLQEQP
ITLPPGSGMFPQLGTSQTPSTAAMTAASSICVLPSTQTVGMTVAPSSNEPEGSYQLQHMT
QLLASKSGILPSQLDITSASGNQLSSFPQLVDVPNTGLEQNKTSSSVMHASSASPGGSPS
SGQQSASSSVLGPTKSRPKVKRIQLPLDKGNGKKHKVSHMRTSSSEAHIPDPEANSTSLT
SVTGTPGSKSDVQDTTNMDQSSQKDCGQSIRQMTAIPEEPPTQNSTNEQDSSEPKVTEEE
ESNFSSPLMFWLQQEQKRKESIGEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQ
EARSNARLKQLSFAGVNGLKMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPL
NPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPM
RFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYESK
GIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGE
ELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
Download sequence
Identical sequences F7FMK4
ENSMODP00000016853 ENSMODP00000016853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]