SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016991 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016991
Domain Number 1 Region: 507-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.98e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily POZ domain 4.34e-21
Family BTB/POZ domain 0.0019
Further Details:      
 
Domain Number 3 Region: 423-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 384-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000846
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 326-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000103
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 469-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000508
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016991   Gene: ENSMODG00000013582   Transcript: ENSMODT00000017305
Sequence length 629
Comment pep:known_by_projection chromosome:BROADO5:6:200575058:200593016:-1 gene:ENSMODG00000013582 transcript:ENSMODT00000017305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRLNQQRLFQPDLCDVDLVLVQQHSVFPAHKGVLAAYSQFFHSLFTQNKQLQRVELSLE
ALAPRGLQQILNFIYTSKLLVNAANVQDVLNAASVLQMADIAASCQDLLDACSLGPPGPV
AMALGPGSSGGGCPPGPASYYCEIKQEVDAPTQPKIYAREGTDPFSVRVEDGAGLGGSTA
IGLTPVSAKPFYKEEKEEASGAEGTAPRALCKLEGAEDSEEDLEGQGAYSGEQQQIIVEV
NLNNQTLHVSKGPEGKPPAADTGEATVATRSSVATRSREGTKQGVSGEEEEEGVEEGARR
GRKRRKDAQLPAPAPDGLGPKVKLEEKQHHPCQKCPRVFNNRWYLEKHMNVTHSRMQICD
KCGKRFLLESELLLHHQTDCERNIQCVTCGKAFKKLWSLHEHNKIVHGYAEKKFSCEICE
KKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRSMSLKVHSLQHSGEKPFKCENCNERFQ
YKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYFDEHMKTHTGEKPYICEICGKSFTSRPN
MKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAHKEKCFRVSHPMTSDTPDGGDHPPGLTLA
LTPVPPGAAPATPTQPGLPPPQPPPPPHT
Download sequence
Identical sequences F7AW03
ENSMODP00000016991 ENSMODP00000016991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]