SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017086 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017086
Domain Number 1 Region: 564-578,615-986
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.49e-99
Family Formin homology 2 domain (FH2 domain) 0.00000597
Further Details:      
 
Domain Number 2 Region: 7-327
Classification Level Classification E-value
Superfamily ARM repeat 4.86e-76
Family Diap1 N-terninal region-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017086   Gene: ENSMODG00000013660   Transcript: ENSMODT00000017402
Sequence length 1277
Comment pep:known_by_projection chromosome:BROADO5:1:309172491:309218994:-1 gene:ENSMODG00000013660 transcript:ENSMODT00000017402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKEGVQKKWAALKEKLGPQDGDPTEANLENAEPELCIRLLQMPSVVNYSGLRKRLESS
DDGWLVQFLEQSGLDLLLEALARLSGRGVARIADALLQLTCISCVRAVMNSQQGIEYILS
NQGYVCKLSEALDTSNVMVKKQVFELLAALSIYSPEGHKQTLDALDHYKVVKSQQYRFSV
IMNELSSTDNVPYIITLLSVINAIILGTEELRARTQLRNEFIGLQLLDILTKLRDIEDLD
LLIQCETFEEAKSEDDEELLRIFDGIDMSSHQEVFSTLFNKVSCSPISVQLLSVLQGLLH
LEPAQHSSLLLWEALEILVNRAVLLASDVQESSIEEIVERLLSMKMRPQQSPKICNLVKT
AHKCIQTNLDRAGSSPKGSQKEKGARPLSDNGTLETVTAFQMQTASATPELHTSTPDPAV
VPHVGKTSIPPPPPPPPLPSFLWAPPPATPMSSKTSVPSPPPPPPPPPLPGMTRTPSTTP
PCPPLPGVGGIPPPPPLPGLGGIPPPPPLPGLGGIPPPPPLPGLGSIPPPPPLPGLGGIP
PPPPLPGLGGIPPPPPLTGMACVPPPPPPLYGEIPPPPMNGTEEIIVAHVDHGLGLVRVP
NHRKVNPPTLRMKKLNWQKLPSNVVRDSHSMWASVSSLSNETMEPDYSSIEQRFCFPITK
PKEKEAAPVKKEPKEITFLDAKKSLNLNIFLKQFKCPNEEITDMIRRGDRTRFDVEVLKQ
LLKLLPEKHEMENLKSFQEEKAKLASADQFYLLLLNVPSYQLRIECMLLCEETVIILDMI
KPKAEVIRKACESLLTSQRLPIFCQLILKIGNFLNYGSHTGDADGFKISTLLKLTETKAN
QSRVTLLHHILEEVEKNYPDLLQLPNDLEHISRAAGINIDVIHSEASTNLKQLLEMERKV
SSGIPEVQEQYVKPLQDSISASRELEEEFKVIERQKIKLADYLCEDAHKLSLEDTFSTMK
TFRELFIRALKENKDWKEQAVKAEKRKKQLEAEEAKRPRGEDGKIIRKGAVKQEEVCVID
ALLADIRKGFQLRKTAKGKADSENGLKAAPPETSKEKEAVIKDTGSSTNSGQDFDLAAAI
GETSDQDNPDGPGSTGGIPKGHSEVSGSGCRNPEGNKVSTPMAGFPDDPHMIQFDDSKSL
KPIKFSSGSFSGGTNMGSEVDATRTGDQASEHQADRTSEGPKNGFQRSEEAESTPPEGEE
EEEEEDTAPDSVLDTSLDRSFSEEAITDSSGSGTLPRSQERTKKGSGKRRKKRHSRSHEE
VDSDSGDVKTKWPCVVQ
Download sequence
Identical sequences F6TXY8
ENSMODP00000017086 ENSMODP00000017086 XP_007473532.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]