SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017132 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017132
Domain Number 1 Region: 73-191
Classification Level Classification E-value
Superfamily POZ domain 3.73e-28
Family BTB/POZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 448-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 3 Region: 427-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000891
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017132
Domain Number - Region: 380-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00291
Family Classic zinc finger, C2H2 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017132   Gene: ENSMODG00000013701   Transcript: ENSMODT00000017450
Sequence length 514
Comment pep:known_by_projection chromosome:BROADO5:1:308836213:308840080:-1 gene:ENSMODG00000013701 transcript:ENSMODT00000017450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTVGPRAAGAGGGGAARGRDQPAPGGGGEGGVTKESKKLQGSGEGQSSWAPGPGGSGRAR
DFSCLCPGYEGRMEFPDHSRQLLQCLSQQRHQGFLCDSTVLVGEARFQAHRAVLASCSMY
FYLFYRDQLDKREIVHLNSDIVTAPAFSLLLEFMYEGKLELSSLPIEDILAAASYLHMYD
IVKVCKGKLKEKELVAEEEKDRPFLGPSISLGQDLELSGPPRFSPLEYDRAGAHPTWPTN
LMGPSSLSKKAELSPSPGKAKPLDNGVGVSLSQRPELPIPSQGPGDSECALDLSLKPISG
RDALHTSYLMVKDEQDSLSDQEDAEARSPEGQPFGPVAKSLVTGLGHMFHGQEDELDPER
EESEDDLDASDLSASEVLGPPGHICICPLCSKVFPNPHVLQLHLSSHFRDKDGGSRARLS
PEGSVPTCTLCGKTFSCMYTLKRHERTHSGEKPYTCVQCGKSFQYSHNLSRHAVVHTREK
PHACKWCERRFTQSGDLYRHIRKFHCGLVKSLVV
Download sequence
Identical sequences F6YAG3
ENSMODP00000017132 13616.ENSMODP00000017132 ENSMODP00000017132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]