SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017161 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017161
Domain Number 1 Region: 33-121
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.43e-33
Family SCAN domain 0.00014
Further Details:      
 
Domain Number 2 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.23e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 208-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-22
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.08e-20
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 787-838
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-19
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 6 Region: 711-760
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-19
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 936-992
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 443-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-16
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 9 Region: 824-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000041
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 648-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000594
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000119
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 12 Region: 385-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000588
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 13 Region: 894-929
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000664
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017161   Gene: ENSMODG00000013724   Transcript: ENSMODT00000017480
Sequence length 1008
Comment pep:novel chromosome:BROADO5:6:199734256:199768077:-1 gene:ENSMODG00000013724 transcript:ENSMODT00000017480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITRTTLDSGNHAMLKNKNDNWGRKSHRERNISSGPELFRQLFRQLRYQDTSGPQEALVR
LQELSRWWLRPDIHTKEEILDRLVLEQFLTILPGDTRTWVLLHHPENGKEAVALVKDVES
HFEEQEMEVAAPAQVQDGNLWMGTTSLGASQESLPRPSLGDHFSGRPPSDAATAHLQDPL
NVPPTPQVPAGPQEGSTGDLAVAGSPGARLQESMTFEDVAVYFSKAEWTLLSPAQQVLYR
NVMLENYENLASLACPFPKPIVISNLEQASWDLQEALVQDLRNTYAGDESQKENKKLAPA
RESAEADPEASSPGGLQTCAPQQPEFEESAEHDHNREKPGGNSALEIVTGEERGSRYMLG
KDVKATAGEAGESVESCYQSTPKPQKIYKCGECSMYFRHSWDLLQHQKTHSGENSLPCGE
VGSAFSHTSGSSQAQRIKGENMPHKCKDCNKSFNHRSHLEHHQRLHTRERPYKCKECGKT
FRWSSNFARHRRIHTVPKHYECQECGKEFTRISQYIIHQKFHFTKKLHIRNRYGRTFRHI
STRNTHRKVHAGEKRYKCKECGKTFTRNRTLLDHQRIHSGEKPYRCNDCGKTFTRNRTLV
DHQRIHSGEKPYRCNNCGKTFTRNRSLVEHERIHTGERPYECSKCGKAFNRKSYLFLHER
THNKKKPYKCDICGKDFRWGSGFARHRRSHTEEKYNEVNEQRGVFPHGSDVQHQRIPTEE
KSYECQECGKTFTRKRTLIDHQRIHSGEKPYECSQCEKTFSCRPYLIAHQRTHIPKVHQK
NQIMENYYKCSQCGKSFSQKSTLLIHQRLHTGERPYKCSVCGKAFRWKSNFIQHQKRHPG
MKQHKCQECGKVFSQKDILLAHQMIHSGEKIFKDQYGGKKNRNTKRLIEYLQRRDCEKPY
KCTKCGQSFSSASVFSLHCKIHTGGKTYENDNADIFPQNSSLTSHQEFQTREKVYKCNMC
DKAFPKKSQLIMHDRFHTRERPYRCNKCGKKFRWSSNLSRHQKSHIAE
Download sequence
Identical sequences F6XQP6
ENSMODP00000017161 ENSMODP00000017161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]