SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017163 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017163
Domain Number 1 Region: 564-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000193
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 1080-1130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000347
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 3 Region: 496-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000988
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1035-1088
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000448
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 5 Region: 621-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000527
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 6 Region: 250-274,462-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000952
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 7 Region: 648-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000704
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017163   Gene: ENSMODG00000013728   Transcript: ENSMODT00000017482
Sequence length 1349
Comment pep:known_by_projection chromosome:BROADO5:1:449544925:449567023:-1 gene:ENSMODG00000013728 transcript:ENSMODT00000017482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEENEVESSSDAAPRPAQEEPSESGLDVGTSEAMSADSSDATATAPGPSLLSEADDSVVG
QSSDHGTRSLEEVSESSSSRDATPQGYLPDSSSIGPSALVSSGSAGGPPVLVHSSVLADA
AMLVSDSTASSSDLGSAIDKIIESTIGPDLIQSCIAVTSAEDGGAETTQYLILQGPDDGA
PMVSPMSSSALAHSLAAIEALSDGPTSTSTCMEPAEAQGCSPTTNPPPGPTEEPDLQSLE
AMMEVVVVQQFKCKMCQYRSSSKGTLLRHMRERHFRPASTTTALKKGRSRKWGASAKPQE
EEGPEEEEDDDIVDAGAIDDLEEDSDYNPAEDEPRSRQPRPQRPIPTSSAERPRRRPGRP
RKLPRLDLLTPPEGVEGESLVSSQSGHGLLELQGPEATSSSGPEPCGPSEGSAEPSVSQS
DAENTAPNTREDSDVPPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPYLCRICGSRFLSHE
DLRFHVNSHEAGDPQLFKCLQCSYRSRRWSSLKEHMFNHVGSKPYKCEECSYTSVYRKDV
VRHSAVHNRDRLVEPSQPPKLSSFPCPVCSRVYPMQKRLTQHMKTHSTEKPHMCDKCGKS
FKKRYTFKMHLLTHIQAIANRRFKCEFCEFVCEDKKLLLNHQLSHVSDKPFKCNFCPYRT
FREDFLLSHVAVKHTGAKPFACEFCHFTTRHKKNLRLHVRCRHSASFEEWGRRHPEEPPC
RRRPFFSRQQIEELKQQHGQRPGLPESATLDPPDSPEVRTSATPETSQLLCPEALGGATI
IYQQGAEESTALATQTALDLLLNMSTQRELGGAALQVAVVKSDGIRAELSSSPGEPGSPG
ASPQVVTLHVAESGSSFAGEGPVGVSDLQQITLAPVPYNGASYSVIAAPPMEEGTSAPGT
PYSQEPPGEAAQAVVVSDALKEPSTHYIMAADGTQLQHIELSADGGVSFSGPGVADTPES
GTKWPLLQCGGRPLGRDGPAPPSPARALRAGVTPVEDRVPPTSTSPLAPSPPPSSSTAAA
TSAKKFSCKICSEAFPGRAEMESHKRAHTGPSTFKCPDCSFIAHLWPEVRAHMAQHSSLR
PHQCSQCSFASKNKKDLRRHTLTHTNEKPFSCHLCGQRFNRNGHLKFHIQRLHSPDGRKP
GPPVPRAPPRASTQTIILNSDDETLATLHTALQSSHGVLGPDRLQQALGQEHIIVAQEQT
VANQEEATYIQEITTADGQMVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPEGHHIQVQ
EGQITHIQYEQGTPFLQESQIQYVPVSPGQQIVTQAQLEAAAHSAVTAVADAAMAQAQSL
FGTEEAMPEHIQQLQHQGIEYDVITLTDD
Download sequence
Identical sequences F6XQM4
ENSMODP00000017163 ENSMODP00000017163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]