SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017392 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017392
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-23
Family HkH motif-containing C2H2 finger 0.0000641
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017392   Gene: ENSMODG00000013904   Transcript: ENSMODT00000017714
Sequence length 159
Comment pep:known_by_projection chromosome:BROADO5:2:273423508:273446047:1 gene:ENSMODG00000013904 transcript:ENSMODT00000017714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPGGAMIPPPPNLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
Download sequence
Identical sequences F6VBS4
ENSMODP00000017392 XP_001378181.2.35504 ENSMODP00000017392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]