SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017540 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017540
Domain Number 1 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000983
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017540
Domain Number - Region: 265-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.011
Family Classic zinc finger, C2H2 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017540   Gene: ENSMODG00000014029   Transcript: ENSMODT00000017866
Sequence length 467
Comment pep:known_by_projection chromosome:BROADO5:X:43801821:43808557:1 gene:ENSMODG00000014029 transcript:ENSMODT00000017866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMLLDGGPQFPSLGVGGFGAPRHHEMPNREAAGMGLSPFGDASHAAAAAFKLSPAAAHD
LSSGQSSAFTPQGSGYANALGPHHHHHHHHHHHAGQVPSYGGAAAAFNSTRDFLFRQRGS
GLGEASSGGGQHGLFAGSPGSLHGPPGIAEPPGYLLFPGLPEQSPNHPSPTAHVDNNQVH
LGLRGELFGRPDPYRAVGSPRTDPYAAGAQFHNYPPMNVNMGMNVAAAAAAHHGPGAFFR
YMRQPIKQELACKWLEEAQLGRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHICYWEE
CPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHTGEKPFKCE
FEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPAA
SSGYESATPPAIASANSKESAKTPPSAVQTSTSHNPGLPPNFNEWYV
Download sequence
Identical sequences F6V8L0
ENSMODP00000017540 XP_001363758.2.35504 13616.ENSMODP00000017540 ENSMODP00000017540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]