SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017572 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017572
Domain Number 1 Region: 166-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 211-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 3 Region: 110-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000017
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 2-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000232
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 67-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000614
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 271-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000911
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017572   Gene: ENSMODG00000014052   Transcript: ENSMODT00000017898
Sequence length 324
Comment pep:known_by_projection chromosome:BROADO5:Un:44174427:44183291:-1 gene:ENSMODG00000014052 transcript:ENSMODT00000017898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLERHSISHSELKPHTCPACGKAFKRASHLRRHRNIHAGLRPFHCALCPRRFREAGEL
AHHGRVHSGERPYHCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHR
RSHRQKRGFRCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVCGRGFLRSWYLRQHRVVHT
GERAFKCAVCAKRFAQSSSLAEHRRLHAVARPQRCGACGKTFRYRSNLLEHQRLHLGERA
YRCEHCGKAFFYLSSVLRHQRAHEPARPELRCPACLKVFKDPGYFRKHLAAHQGGRPFRC
SACGEGFSNTYGLKKHRLVHKAER
Download sequence
Identical sequences H9H6N3
ENSMODP00000017572 13616.ENSMODP00000017572 ENSMODP00000017572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]