SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017621 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017621
Domain Number 1 Region: 29-147
Classification Level Classification E-value
Superfamily POZ domain 6.8e-28
Family BTB/POZ domain 0.0023
Further Details:      
 
Domain Number 2 Region: 404-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000222
Family Classic zinc finger, C2H2 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017621   Gene: ENSMODG00000014092   Transcript: ENSMODT00000017948
Sequence length 490
Comment pep:known_by_projection chromosome:BROADO5:2:271105386:271106858:1 gene:ENSMODG00000014092 transcript:ENSMODT00000017948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPSPLAPVPPSPGCAPAASCPGSAPRTIQIEFPQHSSSLLEALNRHRLEGKFCDVSLQ
VQGRELRAHKAVLAAASPYFHDKLLLGDAPRLILPNVIEADAFEGLLQLIYSGRLRLPLD
ALPAHLLVASGLQMWQVVDQCSEILRKLGGGTSNHTLLLSSSSSPGIWCSRPAPSQSPIQ
PLVQPSVQPPVQPLVQPPVQPLTPSESPVVGMGGELGEVLQIQVEEEEEEEEEEEEEEEQ
RTLPVVPQTQTPRVAGVAPLLCAPTTLLVSTTTRRLPDGEGAPVEALTPPAPLPPKIIYI
KQEKVETEEEVVVGGAQPGGGMEESRGGFSGGGTGTGGGDLVFLLPPSAGGTSNGGGPSW
KPVDLHGNEILSGGAGPGGTGQAVHGPVKLGGAPPPDGKRFGCLCGKRFAVKPKRDRHIM
LTFSLRPFGCGVCNKRFKLKHHLTEHMKTHAGALHACPHCSRRFRVHACFLRHRELCKGQ
GWATAHWTYK
Download sequence
Identical sequences F6QJQ4
ENSMODP00000017621 XP_007483747.1.35504 ENSMODP00000017621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]