SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017659 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017659
Domain Number 1 Region: 677-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 397-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 229-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-25
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 565-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-25
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 621-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 173-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-24
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 10 Region: 509-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 11 Region: 733-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 12 Region: 118-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 13 Region: 789-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.32e-22
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 14 Region: 835-887
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.41e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 15 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 16 Region: 79-130
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.87e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017659   Gene: ENSMODG00000014123   Transcript: ENSMODT00000017987
Sequence length 889
Comment pep:novel chromosome:BROADO5:1:551932129:551943179:1 gene:ENSMODG00000014123 transcript:ENSMODT00000017987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVTVDFTQEEWCLLSPPQKELYKEVMLENAQNLISVGLPAPSEEVISYLEQRET
PWMLEQEDLRSFYPGEGGKHYECKQCGKIFPSNSNLVVHQRIHTGDNPYECKPCGKKFSQ
RSHLAIHQRIYTGNKPYECKQCGKVFTTNSSLAVHQRIHTGERPYECKQCGKTFSQNSNL
AVHQRIHTDERPYKCKQCGKTFSQRPYLAVHQKIHTRDKPYECKQCGKTFSRTSNLAVHQ
RIHTGERPYECKQCGKTFTDKSNLAVHQRIHTGNKPFECKQCGKTFSQTSHLAVHQRIHT
GERPYKCKQCGNTFSQRSYLAVHQRIHTGERPYECKQCGKTFSRSSNLAVHQRIHTGERP
YECMQCGKTFPSNSNLAVHQKIHTEERPYKCKQCGKTFSQRSYLAVHQRTHTGDKPYECK
QCGKTFSRSSNLTVHQKIHTGERPYKCKQCGKTFSQKSYLAVHQRIHTGDKPYECKQCGK
TFIWRSHLAVHQRIHTGNKPYECKQCGKVFTANSNHAVHQRIHTGERPYECKQCGKTFSR
RSHLAVHQRIHTGNKPYECKQCGKAFSQRSHLAVHQRIHTGNKPYECKQCGKVFTANSSL
AVHQRIHTGDKPYECKQCGKTFPSNSNLAVHQRIHTGERPYECKQCGKTFSQTSHLAVHQ
RIHTGERPYKCKQCGNTFSQRSYLAVHQRIHTGERPYECKQCGKTFSRSSNLAVHQRIHT
GERPYECMQCGKTFPSNSNLAVHQRIHTEERPYECKQCGKTFGRRSHLAVHQRIHTGERP
YECKQCEKTFSRRSHLAVHQRIHTWKKLYDCKQCGKAFNQRSHLAVHQRIHTGNKPYECK
RCGKVFMANSNLAVHQRIHTGERPYECKECGKTFSWRSYLAVHQRIHTV
Download sequence
Identical sequences F6Y3S2
ENSMODP00000017659 ENSMODP00000017659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]