SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017683 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017683
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 4.71e-29
Family BTB/POZ domain 0.000000707
Further Details:      
 
Domain Number 2 Region: 556-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 500-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-16
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 4 Region: 460-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000187
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 5 Region: 597-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 406-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000816
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017683   Gene: ENSMODG00000014130   Transcript: ENSMODT00000018011
Sequence length 674
Comment pep:known_by_projection chromosome:BROADO5:4:237931398:238174870:-1 gene:ENSMODG00000014130 transcript:ENSMODT00000018011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTETTMADGGAEEEEDRKARYLKNIFISKHSIEDSGYAGVAGQHLPGAL
AEQNPSVSTSFGLAAMSPTKAAVDSLMSIGQSLLQGALQPPGVPDDSGLASVGRHPGVAE
VKTEMMQVDEAPGQDSPGAAESSTSGGVGDKAEERSKDGPGTPTRSSVITSARELHYGRE
ESTEQPSLPAEASQGAPGRPEHSVASAEKHLGIYSVLPNHKADSVLSMPSSMTSTLHMQP
AALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKTENRAMGEQCSVCGAELPDNDAV
EQHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETH
RQTHTGTDMAVFCLLCGKRFQTQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRS
HTGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGE
KPFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPP
DWRIEKTYLYLCYV
Download sequence
Identical sequences F6XK25
13616.ENSMODP00000017683 ENSMODP00000017683 XP_001381226.1.35504 XP_007494825.1.35504 XP_007494826.1.35504 XP_007494827.1.35504 ENSMODP00000017683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]