SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017708 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017708
Domain Number 1 Region: 96-201,486-599,648-751
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-52
Family Quinoprotein alcohol dehydrogenase-like 0.023
Further Details:      
 
Domain Number 2 Region: 104-452
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-29
Family WD40-repeat 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017708
Domain Number - Region: 38-45
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017708   Gene: ENSMODG00000014161   Transcript: ENSMODT00000018036
Sequence length 1587
Comment pep:known_by_projection chromosome:BROADO5:4:384114914:384151626:1 gene:ENSMODG00000014161 transcript:ENSMODT00000018036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALEPGVGGYGRSEAGTRGEKEKQPGPVSSRRTLVSPPPPPPPPLCLKRRLKLLPGPEE
TVQSRVTLEKVLGITAQNSSGLTCDPNTGYIAYLAGCVVVVLDPKKSKQQHIFNTARKAL
SALSFSPDGRYIVTGENGHRPAVRIWDVEEKSQVAEMLGHKYGVACVAFSPNMKHIVSMG
YQHDMVVNVWDWKKDSVVASNKVSCKVIAISFSEDSSYFVTVGHRHVKFWFLEVSKEVKV
TGTVPLVGRSGILGELHNNVFCGVACGRGRMAGNTFCVSYSGLLCQFNEKRVLEKWINLK
VSLSSCLCVSEDLIFCGCTDGTVRIFQTHDMHYVTNLPKPHYLGVDVAQGLDPSFLFCRK
AQAVYPDTVALAFDPCHYWLSCVYKDHSIYVWDIRDLSKVGKVWSDLFHSSYVWNVEVYP
EFEDQRACLPSGSFLTCSSDNTIRFWNMENSPTSGRPKNVFSNNLLKVVYVENDIQHLQD
ISHFPDRGNENGTPVDMKSGVRVMQVSPDGQHLASGDRSGNLRIHELRFMDELIKVEAHD
AEVLCLEYSKPETGMTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDI
QMISCGADKSIYFRSAQKVSDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRV
YNTVNGKQKKCYKGSQGDDGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGH
SEIVTGMKFTYDCRHLITVSGDSCVFIWQLGPEITNCMKQHLLEIDHIEQQKKMKDGKWT
SQLRRETYVSMPSGTHSLSPGEQTEDELEEECEQEELLKTPTKDSFETDPRCLLTNGKLP
LWAKRLLGDDDVDGATFHAKRSYQPHGRWAERADREPIKTILDARDLNYYFSPVNPDVLE
DSGLEKVEPQSLTQLLTETEGQEGGSQREGSFQHPDFLQLDLESPKSNDIIIYNLESEAI
PGKSEYRLKEADVSSSQRGNGYLRGPTVLTGELDSCTLEQQPEGGESLESEAETEAETVD
LEGGFKAILSSSPQPKAEKSSFDPIPQAPESTSEVELSGSEGPGPPGSSLPQTPEQEKFL
RHHFETLTDAHPEELFNDTLKDVEPPEMDADSEKSFFLNSRLSMSTQFLSRFQKNSRFAH
TFPPTLPLQLVKPLEAVVLRREGGKSVRTNRSCNNAEASDGLPGEKEAESPETPEPASWC
PLASGITGIGPNPPPEALLGLPLEKERERKPKRSPPLPSSVARGSRALPARSYAEATMSS
RAKMSRSVSLGENVVPALYGLKRPLSMGELSTLGRDGLPSRTRELNSLEGNQNQPPWGNH
EARAGLRLDLTNVSDQFLLPLAPTVIPGPPETGLGRGWTKGSIATVEAVPAEFLASDTPT
EMKAPGLYEPDFLQRLSGPEPPARAHTESPAAMESRGPRCIGSEAPLLDPPPAQLGMSSV
ECITQKLQRSFQEALDLYNMVVSSPRMGGQQQQVLAELSSTFLWIQGQLDAMAWLCGEEV
VQPPSPSLSPALSPAQGLALAPAPASAWTLSPSPAVSPAPGLPTPLLWSLPSSEVRALLE
HYSELLVQAVRRKAGGRELRAGQGSRA
Download sequence
Identical sequences F6UN22
ENSMODP00000017708 ENSMODP00000017708 XP_007491932.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]