SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017713 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017713
Domain Number 1 Region: 126-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000491
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000017713
Domain Number - Region: 105-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000538
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 195-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0069
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017713   Gene: ENSMODG00000014166   Transcript: ENSMODT00000018041
Sequence length 224
Comment pep:known_by_projection chromosome:BROADO5:4:384152276:384153893:1 gene:ENSMODG00000014166 transcript:ENSMODT00000018041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPPLPNAFLQRPLGSVMASLTPGQLLSLPTAMPRSFLVRSCRPQPRDWGHITDQHRGDA
YIPGNSCPETPPMPTGRGLGSQGLAQEVLKAEQIPAVGQAPGGLSCPLCPKVFPLQRMLT
RHLKCHNPARRHVCSCCTKGFHDAFDLKRHMRTHTGIRPFRCAACGKAFTQRCSLESHLG
KIHGQPPRYGYRERREKLHVCEDCGYTSARTEDYTQHRALHPGQ
Download sequence
Identical sequences F6U7P6
ENSMODP00000017713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]