SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017774 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017774
Domain Number 1 Region: 143-277
Classification Level Classification E-value
Superfamily Acid proteases 2.11e-43
Family Retroviral protease (retropepsin) 0.0000693
Further Details:      
 
Domain Number 2 Region: 21-152
Classification Level Classification E-value
Superfamily dUTPase-like 3.4e-23
Family dUTPase-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017774   Gene: ENSMODG00000014218   Transcript: ENSMODT00000018102
Sequence length 296
Comment pep:novel chromosome:BROADO5:2:109042975:109043865:1 gene:ENSMODG00000014218 transcript:ENSMODT00000018102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSSGKRGAGLLREPLSSSLTRAIAGSAGLDLCASTTRILTPEEGPIILPTGKFGPPPPG
MFFLVIGRALTTLQGVVVHPTLVDNDYTGEIKIIIESPHGPVTIPAGKRLAQALPLPMIG
NFPAVAHTRGPSSPGSSNIYWVQQLTESRPTLKLKIEGKTFTGLLDTGADSTVISQAHWP
RSWPLQPSSTHLSGIGQVQDTLQSSKILTWQDTEGNRGTTRPYVVAGLPVNLWGRDILAQ
MRLLMVSPSDPVTTMMLKSGYLPGKGLGKREQGLPHPISFRPHKDREGLGLQSFCS
Download sequence
Identical sequences F6T9V9
ENSMODP00000017774 13616.ENSMODP00000017774 ENSMODP00000017774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]