SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017934 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017934
Domain Number 1 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000963
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 2 Region: 658-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000012
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 543-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000195
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 447-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000239
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000223
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000558
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017934   Gene: ENSMODG00000014346   Transcript: ENSMODT00000018264
Sequence length 734
Comment pep:known_by_projection chromosome:BROADO5:X:53537563:53560186:1 gene:ENSMODG00000014346 transcript:ENSMODT00000018264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVSGMAGTARIDGDHIFVSVPEALLVSDVVTDDGINLDHGLASEVVQGPDIVTENDFVTD
GVFVPESVLEADIAIEEILGISDHILTSDLITETVRLPNQIFVADLVTGPEGHLEHVGQD
SVSGADSPTIVSEEVLVTNSDTEAVIQAASTLPGSTVALKTEDDDDGKSTSEDYLMISCK
NQRISAWANPPVKINTEASNDDVTKEDEFGSEVIKVYIFKAEAEDDVEIGGTEVVTDSDF
HNGHSVPGVLEQQGCVGRLQREKMVYMAVKDSSHEGEDIRDESLPQRYEDCEASGNNLDT
RLENKDGTPAQYLQICDSVNTNKALKQKSKRRKRGESRLWQTAIIIGPDGQPLTVYPCYI
CGKKFKSRGFLKRHMKNHPDHMIKKKYQCTDCDFTTSKKVSFHNHLESHKLINKVDKTLE
LTEYTKRYKEASPLSSNKLILRDKEPKIYKCKYCDYETAEQGLLNRHLLAVHNKHFPHVC
VECGKGFRHPSELKKHMRTHTGEKPYHCHHCIFRCADQSNLKTHMKAKHGTILPYKCEHC
PQAFSDEAELQQHLELFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCEKG
FHRPSELKKHGETHKGKKVHQCRHCDFRTSDPFVLSGHILSVHTRDPPLKCKRCKRGFRQ
QTELKKHMKTHSGRKIYQCQYCDYNTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSE
KNQHIMRHHKETII
Download sequence
Identical sequences F6U5S4
13616.ENSMODP00000017934 ENSMODP00000017934 ENSMODP00000017933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]