SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000017944 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000017944
Domain Number 1 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.28e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 577-634
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 745-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 13-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.02e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 633-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 801-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 12 Region: 847-899
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 13 Region: 484-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000725
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 14 Region: 216-270
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000131
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000017944   Gene: ENSMODG00000028243   Transcript: ENSMODT00000018274
Sequence length 904
Comment pep:novel chromosome:BROADO5:8:23180656:23196571:-1 gene:ENSMODG00000028243 transcript:ENSMODT00000018274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSELPAAPSSLESVTFQDVTIDFTQREWRQLTHAQKSLYREVMLENYENFVSVGFPGSK
PELISQLECGKGPWMLLEEEVRSRCRDWEFQSETKKTFSIQYISLEDTSQERLTKGGPWD
HEFGEVDNCKNNFDGHIANQERDLIEGTRDKILNRTKGRKSNQFMKSFNQNPVLDTPRKV
SSEKKLYKYDTNKNNIFSSDLSDRNEISGKKSRKKAFNDPSDLSEDQRIATKEKPYTFTE
FGNAFHQKRHHTQCHRSGKPYICRDCGKTFNQITYLIQHQGIHDGERPYKCSDCGKAFTN
SSSLILHHIIHSGEKPYECHECRKLFSNRTGLFVHLRIHTGEKPFQCNICKKAFSQKGDL
SRHQKVHTGEKPYKCNICGKAFSQQGHLTAHQRTHNGEKPYKCNECGKAFSNSSSLILHH
RIHSGEKPYECPECGKPFSNHAGLIVHQRIHTGEKPYKCDICEKAFSQKGHLSEHQRIHT
REKPYSCNICKKAFSQRGDLFRHQKIHNGEKPYDCGECGKAFSQKGDLTKHLRIHSGEKP
YKCNKCGKAFSISSQLNMHERIHTGEKPYKCNLCERAFIQKGRLTEHYRIHNGDKPHKCA
ECGKAFTQITYLTRHERIHTGEKPYKCNECEKAFSNSSALNVHQKIHIGVKSHVCLECGK
AFLHSIGLSLHQRVHTGEKPYKCDICEKAFSQRGDLSRHQKIHNGDKPYKCSDCGKAFTQ
RGHLTEHQRVHSGEKPYKCKDCGKAFSNSSQVTLHYRIHTGEKPYKCNECGQAFSRPGSL
SEHQKIHSVEKPYKCSECGKVFSRNLYLSRHQTVHTGEKCYPCNECSKAFRNSHCLTLHQ
RIHSGEKPYQCSECGKAFGRKLYLTQHQRIHSGEKPYECTTCGKAFTRCTTLIQHQKIHT
RNKS
Download sequence
Identical sequences F6U4U4
ENSMODP00000017944 ENSMODP00000017944 XP_007502894.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]