SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018031 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018031
Domain Number - Region: 45-55
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 93-154
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0759
Family SNARE fusion complex 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018031   Gene: ENSMODG00000014423   Transcript: ENSMODT00000018363
Sequence length 222
Comment pep:known_by_projection chromosome:BROADO5:4:364568744:364569451:1 gene:ENSMODG00000014423 transcript:ENSMODT00000018363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGCRISACGTAPRPGEPPPPPFSPPLPPHSSPAPSDPGDEQGSPPPSPPPQPPPHPQSA
ASEKGTGRGLELQRWRPGGHGAAGAAAAGSRALELAEARRRLLEVEGRRRVVSELESRVQ
HLHRVFLAAELRLAHRAESLSRLGGSVSQAELYLAAHGQRAKKGLRRGKRPRPPALLASA
LGLGGCVPWAAGRLRRAGAAAASPEPDSPFRRSPPRGPASPQ
Download sequence
Identical sequences F7BGK9
ENSMODP00000018031 13616.ENSMODP00000018031 ENSMODP00000018031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]