SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018227 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018227
Domain Number 1 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.94e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.63e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.27e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 566-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 608-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 122-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018227   Gene: ENSMODG00000014591   Transcript: ENSMODT00000018559
Sequence length 669
Comment pep:novel chromosome:BROADO5:8:276161084:276169542:1 gene:ENSMODG00000014591 transcript:ENSMODT00000018559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENAWNLLSVGIMDQLRNRIGTNEDLLSRPVEEAETPQMKSSQGLTVAREDVISYFEQR
EVPWMLEQEDLRNCGPEGGIRLEMKETLTEMSLSVEETDKQKLMSDGPYNLTCRKFCVEY
RNPSLLEHQSMHTEEKSSENIQCGKTFTRRESLPRHQRIHCGERPYECEQCGKTFSQRSS
LAMHQRIHSDEKSYECKQCGKTFQQSSNLVRHQRIHSDEKPYECKQCGKTFKVSTSLAVH
QRIHTGQKPYECKKCGKTLTQSSHLAVHQRIHSDEKPYECMQCGKTFKVSTSLVVHQRIH
TGEKPYECKQCGKTFRVKSNLTIHDRIHTGEKPYECKQCGKTFKESSNFARHRRIHTGEK
PYECKQCGKTFKVSSSLVVHQRIHTGEKPYECKQCGKTFKESSNLARHQRIHSDEKPYEC
KQCGKTFRVKSNLTIHERIHTGEKPYECKQCGKTFKESISLARHQRIHTGEKPYECMQCG
KTFKVSSSLAVHQRIHTREKPYECKQCGKTFTQRSHLARHQRIHSDEKPYECKQCGKTFK
VSTSLAVHQRIHTGEKPYECKQCGKTFKESSSLVRHQTIHSGEKPYECMQCGKTFRVRLS
LTQHERIHTGEKPYECKQCGKTFTQRSHLARHQRIHSDEKPYECVQCGKTFRVRPSLTQH
ERIHTGKKP
Download sequence
Identical sequences F7A4Q8
ENSMODP00000018227 ENSMODP00000018227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]