SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018236 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018236
Domain Number 1 Region: 1880-1954
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.41e-32
Family Classic zinc finger, C2H2 0.0000518
Further Details:      
 
Domain Number 2 Region: 539-601
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000732
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number 3 Region: 2058-2108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000505
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 2302-2350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000025
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018236
Domain Number - Region: 2013-2066
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000783
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number - Region: 2194-2241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00156
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number - Region: 1471-1496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00309
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 2407-2433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00327
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 438-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0062
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 105-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00947
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 844-872
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0227
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 886-917
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0278
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Domain Number - Region: 601-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0462
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 1664-1689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.074
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 162-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0766
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018236   Gene: ENSMODG00000014597   Transcript: ENSMODT00000018568
Sequence length 2504
Comment pep:known_by_projection chromosome:BROADO5:6:185653753:185815639:1 gene:ENSMODG00000014597 transcript:ENSMODT00000018568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNIDQSRSASLNASNQTEVEFS
TVKDEFTIAEDISGQNAAVMGAGGYYGHSPGYYGQHLAPHPKPTSKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAGGNSLGPSATGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNNLKETSAPPSTPPSLSDSVAASVQVQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSTLRQQQEGTNLPDVPKSPPSPVPNSS
YVSMNATSHEMPNANVSGFRGSMGNSLIRSSSSPASKYSPVSYPPIKPKPPHNSGLVNLP
ERSRYGMADMTNSSTDLETNSMLNDSSSDEELNEIDSENGLNSMDHQTSGMSAEQLMGSD
GNKLLETKGIPFRRYMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTCK
SSLKLGAHKQCHTGTTSDWDAVNSQGESISASLNEGPMSYESANMNGRKTGVMLETLQQQ
QQQQQQQQQQQPSQPQQPQQLQPQQQPPLPQPQQQQLPQPPPPPPPPPPPPPPTQSQPQH
PYKCTMCNYSTTTLKGLRVHQQHKHSFCDNLPKYEGQTSALPLESDTDGHTSSSNTVKKS
QTSILGLSSKNNFVAKVPRKISNDFPLDLSPVKKRTRIDEIASNLQSKINQTKQQEDAVI
NVEDDEEEEEENEVEIEVELDREEEPTESLMDVPSSFAAQQIWARESNDPQKDSNFRTVP
HDYNATNGAEIELTLSEDEEDYYCTSVNMKDHQASNPALLNNQPSIYAAEHNNESSEFND
SGRLYYCKHCDFSNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNF
EDLQQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMI
FSSYVVEQQEGLNAESQTLREILNSAPKNMATSTPVARGGGVPTAFSKNTPSKTFATECE
NQKDPSVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRVVSVDRGSA
LSQLSFEVGAPISPKMPNMASPPPPQPPPSDLSTELYYCKHCSYSNRSVVGVLVHYQKRH
PEIKVTAKYIRQAPPTAAMMRGAEVPHGAPRPPVPMQRLNRGSSERDVPPVENEMFFCQH
CDYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRGQKKSGGCMLVPSSSTER
EKAKLRALKCRQCSYTSPYFYALRKHIKKDHPSLKATVTSILRWAFLDGLIEAGYHCEWC
IYSHTEPSGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSPPSLTMTAEAKTYKCRDCIFE
ASSIWDITNHYQAFHPWAMNGDESVLLDIIKEKDAAEKILSPSEEIPGQINCENKMISPL
AEQDAECTEDARLSPEKSIQLTSANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMK
VKAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPSIKVTAEDFVHDVEQSAD
LTQHEVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFAQSPPKVAV
TLEPELPPAEVSPSQLPAADEEVAEVSVPASHFSASHLVSHTVFRCQLCKYFCSTRKGIA
RHYRIKHNNVRAQPEGKNNLFKCALCSYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTV
SDKPSKVIIPSPPKDDSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPK
KQHASKLGGYFTAVYADENEKPTLLEEEQPEFERSELETGGIEAQEIEWLPFRCIKCFKL
SFSTAELLCMHYTDHHSKDLKRDFVILGNGTRSLGTAFQCKHCDNRLQSMAELTSHLNSH
NEEFQKRAKRQERRKQLLSKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCV
EVHPTLRAICNHLRKHVQYGNVPSVSAAVKGLRSHERSHLALAMFTREDKYSCQYCSFVS
AFRHNLDRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGDHAYRCSWCSFSTMT
ISQLKEHSLKIHGKALTLPRPRLVSLLSSHAHHSSQKAASTEEVEDSNDSSYSEPPDVQQ
QLNHYQSAALARNNSSVSPGPLSGAEQKTEAILNCEFCEFSSGYIQSIRRHYRDKHGGKK
LFKCKDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRE
ERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETK
HTEELDGHLRDEHKVSRNFELVGRVNLDQLEQMKEKMEMTSSDEEEDKEEEMNSKDLMRF
SDGRVCSEKRFPCEFCGRAFAQGSEWERHVLRHGMSLNDNKQVSREDDHPKENLEEDSKI
TLTEEREVDEEEVEVDFSLKDETVAVCVVAADKSLLENAEAKNE
Download sequence
Identical sequences F7A3X9
ENSMODP00000018236 ENSMODP00000018236 XP_007499692.1.35504 XP_007499694.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]