SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018453 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018453
Domain Number 1 Region: 429-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.82e-16
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 461-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000896
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018453
Domain Number - Region: 412-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0101
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018453   Gene: ENSMODG00000014758   Transcript: ENSMODT00000018786
Sequence length 539
Comment pep:known_by_projection chromosome:BROADO5:1:529381382:529396764:-1 gene:ENSMODG00000014758 transcript:ENSMODT00000018786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTPGTAGLGDASATDIMDICESILERKRHDSERSTCSVLEQTDMEAVEALVCMSSWGQR
SQKNDLLKLRPLTPVSDSGDFTSLHGEAAVTDIPKDFHSFSTLCMTPPHSPDLLEPCSSL
LLPSQVTSQTRTVPANTLISSAPSENTTSTLVAKLSKMKVVLGLSGQKPEVSEPAFLQPC
KAMVTSVIRHTGDSSTSHIPATQGKMEGISGNRNSIRLKETDHSGHSEASQTVHLESGLN
YANLVSCQPRLQNFGSSILSDKGQQEVWPIVTQVCSLKSCESDTTRKSASYISVPVPVRP
PPVLCQMIPVTGQSGGGMVSAFLKPPSQTSQAPIKPILPQTAPISQPVLMGASVPQGAVM
LVFPNAALPQPASCQPNVMTVGNTKLLPLAPAPVFITPSQSCVPSVDFSRRRNYVCNFPG
CRKTYFKSSHLKAHLRTHTGEKPFNCSWEGCDKKFARSDELSRHRRTHTGEKKFVCPVCA
RRFMRSDHLTKHARRHMAAKKIPNWQAEVGKLNRIASSEKPGSTGVSLSPLVPMPSCSA
Download sequence
Identical sequences F7GGZ0
ENSMODP00000018453 ENSMODP00000018453 XP_001381118.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]