SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018457 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018457
Domain Number 1 Region: 171-202
Classification Level Classification E-value
Superfamily WW domain 0.000000000302
Family WW domain 0.0012
Further Details:      
 
Domain Number 2 Region: 130-161
Classification Level Classification E-value
Superfamily WW domain 0.000000000404
Family WW domain 0.00054
Further Details:      
 
Domain Number 3 Region: 9-51
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000025
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018457   Gene: ENSMODG00000014761   Transcript: ENSMODT00000018790
Sequence length 387
Comment pep:known_by_projection chromosome:BROADO5:7:164815676:164847902:1 gene:ENSMODG00000014761 transcript:ENSMODT00000018790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLEKAKEEEK
TSKEFAAMEAAALKAYQEDLKRLGISSDVTESNTPQVTNTAPSISVSSQKKEKKKRKKDL
SNINAVGAAKWVEGMSSEGYRYYYNTITGESQWEKPEGFQGKFSKKTAMPLWIEGLSEDG
YTYYYNTETGESKWEKPEDFVSQVGDPLSSNSSEALGTPAETKSSDSDSDSSEIQETKKQ
EEEEKSETSTEVQKPKIKFRKRTKNDNIEETEPESKKEKSDEDQEQDSSGSVKEKPKSPK
KPNPYGEWKEIKEEDNHYEKVDLELPSTENEYIGAPVADMSGDPKVTFKEKTVTSLGDVA
EGVASVFKKRRFDNGKSRNLRQRGGDQ
Download sequence
Identical sequences F7GGY7
ENSMODP00000018457 ENSMODP00000018457 XP_007501570.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]