SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018464 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018464
Domain Number 1 Region: 479-576
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 8.73e-31
Family CUT domain 0.0000262
Further Details:      
 
Domain Number 2 Region: 366-450
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.68e-28
Family CUT domain 0.0000145
Further Details:      
 
Domain Number 3 Region: 671-735
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000684
Family Homeodomain 0.00015
Further Details:      
 
Domain Number 4 Region: 622-667
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000523
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000018464
Domain Number - Region: 189-245
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00127
Family SinR domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018464   Gene: ENSMODG00000014765   Transcript: ENSMODT00000018797
Sequence length 795
Comment pep:known_by_projection chromosome:BROADO5:8:278473761:278570569:-1 gene:ENSMODG00000014765 transcript:ENSMODT00000018797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDHLNETTQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHS
GHLMKTNIRKGTMLPVFCVVEHYENSIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGY
SHSSAAQAKGLIQVGKWNPVPLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLP
PEQWSHTTVRNALKDLLKDMNQSSLAKECPLSQSMISSIVNSTYYANVSAAKCQEFGRWY
KHFKKTKDMLVEMDSLSELSQQGANHVNFGQQPVPGNTAEQPPSPVQLSHGSQPSVRTPL
PNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHPPPVSRSMNKP
LEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIA
TERNGKPENNAMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSP
ENRTLWENLSMIRRFLSLPQPERDAIYEQESNAVHHHGDRPSHIIHVPAEQIQSPSPTTL
VKGEPRGTFSPSLLTPGPWLGAAPQQQQQQQQQQQQQQQQQQQQPQPQQQQPGPRLPPRQ
PTVASPAESEDENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYT
IIKFFQNQRYYLKHHGKLKDNSGLEVDVSEYKEEELLKDLEESVQDKNANSLFSVKLEEE
LSVEGNTDINADLKD
Download sequence
Identical sequences F7GGS4
ENSMODP00000018464 XP_007505208.1.35504 XP_007505209.1.35504 XP_016281947.1.35504 XP_016281948.1.35504 ENSMODP00000018464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]