SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018479 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018479
Domain Number 1 Region: 31-107
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000103
Family HkH motif-containing C2H2 finger 0.053
Further Details:      
 
Domain Number 2 Region: 197-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000214
Family HkH motif-containing C2H2 finger 0.064
Further Details:      
 
Domain Number 3 Region: 281-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000941
Family Classic zinc finger, C2H2 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018479   Gene: ENSMODG00000014774   Transcript: ENSMODT00000018812
Sequence length 421
Comment pep:known_by_projection chromosome:BROADO5:2:194436825:194442986:1 gene:ENSMODG00000014774 transcript:ENSMODT00000018812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPASSSPNPLLASLPLPARPLQPPLDIKHFLTFHFNGAAPLSLFPNFSTMDPVQKAVISH
TFGVPSPIKKKLFISCNICHLRFNSSNQAEAHYKGHKHARKLKAVEAAKSKQRTHTAGRD
RATGPVTIPPDSRAPGEPQNKAPLAASPGSPLVLLKTLDPTPRESASLDLSDAASSSSSS
SPSCSPSSPGPGAEMSGTRMGAGPGAASSASSDNRNEKGPLYCPTCKVTVNSASQLQAHN
TGAKHKWMVDGHRGAPRRGRGRIMPRGGSGHKAKRVAGAPGGKPGPSPSFHCALCQLHVN
SETQLKQHMSSRRHKDRLAGKPLKAKVSQHSKLQKHGALAVSILKSKLALQKQLTKTLAA
RFLPSPLPTAAVCTLPGPLALRPAPAAATTLFPAPMLGPALFRSPATAVRPATGPIVFAP
Y
Download sequence
Identical sequences F7G754
ENSMODP00000018479 13616.ENSMODP00000018479 ENSMODP00000018479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]